Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T30215
(Former ID: TTDR00328)
|
|||||
| Target Name |
Pseudomonas Histidine kinase AlgR2 (Pseudo algQ)
|
|||||
| Synonyms |
algQ; Transcriptional regulatory protein AlgQ (mRNA); Alginate regulatory protein AlgR2 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
Pseudo algQ
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
The promoter for a critical alginate biosynthetic gene, AlgD, encoding GDP-mannose dehydrogenase, is activated only under conditions reminiscent of the cystic fibrosis lung (i.e. under high osmolarity), and at least two regulatory genes, AlgP and AlgQ, have been implicated in this activation process.
Click to Show/Hide
|
|||||
| BioChemical Class |
Kinase
|
|||||
| UniProt ID | ||||||
| Sequence |
MLESCRNAQERWGGVHQLIDRWLHERQQLVQAFDALSGIQAPAPNAEELQHFCQLLLDYV
SAGHFEVYEQLTAEGKAFGDQRGLELAKQIFPRLEAITESALNFNDRCDNGDCREGACLI AELKVLRQQLHERFELEDCLIEVLHNAHSQSGAEGSAVPV Click to Show/Hide
|
|||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Histidine kinases as targets for new antimicrobial agents. Bioorg Med Chem. 2002 Apr;10(4):855-67. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.