Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T29036
|
|||||
| Target Name |
CCN2 messenger RNA (CCN2 mRNA)
|
|||||
| Synonyms |
Cellular communication network factor 2; Connective tissue growth factor; Hypertrophic chondrocyte-specific protein 24; Insulin-like growth factor-binding protein 8; IBP-8; IGF-binding protein 8; IGFBP-8
Click to Show/Hide
|
|||||
| Gene Name |
CCN2
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Fibrosis [ICD-11: GA14-GC01] | |||||
| 2 | Keloid/hypertrophic scar [ICD-11: EE60] | |||||
| Function |
Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MTAASMGPVRVAFVVLLALCSRPAVGQNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVC
AKQLGELCTERDPCDPHKGLFCHFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSC KYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA AYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNASCRLEKQSRLCMVR PCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTT LPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA Click to Show/Hide
|
|||||
| HIT2.0 ID | T33JS5 | |||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
| 1 | OLX10010 | Drug Info | Phase 2 | Hypertrophic scars | [2] | |
| 2 | PF-06473871 | Drug Info | Phase 2 | Hypertrophic scars | [3] | |
| 3 | RXI-109 | Drug Info | Phase 2 | Fibrosis | [4] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 3 Inhibitor drugs | + | ||||
| 1 | OLX10010 | Drug Info | [5] | |||
| 2 | PF-06473871 | Drug Info | [1] | |||
| 3 | RXI-109 | Drug Info | [6] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | A Placebo-controlled Study of PF-06473871 (Anti-Connective Tissue Growth Factor Antisense Oligonucleotide) in Reducing Hypertrophic Skin Scarring. Plast Reconstr Surg Glob Open. 2018 Sep 6;6(9):e1861. | |||||
| REF 2 | ClinicalTrials.gov (NCT04877756) Study to Evaluate Efficacy of OLX10010 in Reducing Recurrence of Hypertrophic Scarring After Scar Revision Surgery. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT02205476) A Phase 2 Extension Study To Enroll Subjects Who Were Enrolled In B5301001 Study. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT02246465) A Study to Evaluate the Effectiveness and Safety of RXI 109 on the Outcome of Revised Hypertrophic Scars. U.S. National Institutes of Health. | |||||
| REF 5 | Clinical pipeline report, company report or official report of Olix Pharmaceuticals. | |||||
| REF 6 | The current state and future directions of RNAi-based therapeutics. Nat Rev Drug Discov. 2019 Jun;18(6):421-446. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.