Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T27816
(Former ID: TTDI02663)
|
|||||
Target Name |
SNCA messenger RNA (SNCA mRNA)
|
|||||
Synonyms |
PARK1 (mRNA); NonA4 component of amyloid precursor (mRNA); NonA beta component of AD amyloid (mRNA); Non-A4 component of amyloid precursor (mRNA); Non-A beta component of AD amyloid (mRNA); NACP (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
SNCA
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Autonomic nervous system disorder [ICD-11: 8D87] | |||||
2 | Parkinsonism [ICD-11: 8A00] | |||||
Function |
Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores. Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis. Acts also as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5. This chaperone activity is important to sustain normal SNARE-complex assembly during aging. Plays also a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity. Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP DNEAYEMPSEEGYQDYEPEA Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | ION464 | Drug Info | Phase 1 | Parkinson disease | [2] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Elevated mRNA Expression and Low Methylation of SNCA in Japanese Alzheimer's Disease Subjects. J Alzheimers Dis. 2016 Oct 18;54(4):1349-1357. | |||||
REF 2 | ClinicalTrials.gov (NCT04165486) A Phase 1 Study to Assess the Safety, Tolerability, and Pharmacokinetics of ION464 Administered Intrathecally to Adults With Multiple System Atrophy. U.S.National Institutes of Health. | |||||
REF 3 | Clinical pipeline report, company report or official report of Ionis |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.