Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T26357
(Former ID: TTDR00254)
|
|||||
Target Name |
Pseudomonas Aspartate carbamoyltransferase (Pseudo pyrB)
|
|||||
Synonyms |
PYRB; L-aspartic acid transcarbamylase; L-aspartate transcarbamoylase; Aspartate transcarbamylase; ATCase; ACTase
Click to Show/Hide
|
|||||
Gene Name |
Pseudo pyrB
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Involved in allosteric regulation of aspartate carbamoyltransferase.
Click to Show/Hide
|
|||||
BioChemical Class |
Methyltransferase
|
|||||
UniProt ID | ||||||
EC Number |
EC 2.1.3.2
|
|||||
Sequence |
MTPIDAKRPLQLNDQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVISLNVSTSSTSKGETLFDTLRNLEAMAADMFVV RHSDSGAAHFIAEHVCPDVAVINGGDGRHAHPTQGMLDMLTIRRHKGSFENLSVAIVGDI LHSRVARSDMLALKALGCPDIRVIGPKTLIPIGIEQYGVKVYTDLAEGLKDVDVVIMLRL QRERMAGGLLPSEGEFYRLFGLTTARLACAKPDAIVMHPGPINRGVEIESAVADGKHSVI LNQVTYGIAVRMAVLSMAMSGQNAQRQFDQENAQ Click to Show/Hide
|
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Mechanism of resistance of variants of the Lewis lung carcinoma to N-(phosphonacetyl)-L-aspartic acid. Cancer Res. 1981 Mar;41(3):894-904. | |||||
REF 2 | Analogs of L-aspartic acid in chemotherapy for cancer. Cancer Treat Rep. 1979 Jun;63(6):1095-108. | |||||
REF 3 | Aspartate carbamoyltransferase activity, drug concentrations, and pyrimidine nucleotides in tissue from patients treated with N-(phosphonacetyl)-L-aspartate. Biochem Pharmacol. 1982 Oct 15;31(20):3317-21. | |||||
REF 4 | Long-term association of N-(phosphonacetyl)-L-aspartate with bone. Cancer Res. 1981 Jan;41(1):150-6. | |||||
REF 5 | Penetration of N-(phosphonacetyl)-L-aspartate into human central nervous system and intracerebral tumor. Cancer Res. 1980 Sep;40(9):3163-6. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.