Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T25927
(Former ID: TTDR01396)
|
|||||
| Target Name |
Caspase 6 messenger RNA (CASP6 mRNA)
|
|||||
| Synonyms |
MCH2 (mRNA); Caspase-6 subunit p18 (mRNA); Caspase-6 subunit p11 (mRNA); CASP-6 (mRNA); Apoptotic protease Mch-2 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
CASP6
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Cleaves poly(ADP-ribose) polymerase in vitro, as well as lamins. Overexpression promotes programmed cell death. Involved in the activation cascade of caspases responsible for apoptosis execution.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.4.22.59
|
|||||
| Sequence |
MSSASGLRRGHPAGGEENMTETDAFYKREMFDPAEKYKMDHRRRGIALIFNHERFFWHLT
LPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLS HGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDN QTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRETVNGSWYIQDLCEMLGKYG SSLEFTELLTLVNRKVSQRRVDFCKDPSAIGKKQVPCFASMLTKKLHFFPKSN Click to Show/Hide
|
|||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 1 KEGG Pathways | + | ||||
| 1 | Apoptosis | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | TCR Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | FAS signaling pathway | |||||
| PID Pathway | [+] 5 PID Pathways | + | ||||
| 1 | Direct p53 effectors | |||||
| 2 | p75(NTR)-mediated signaling | |||||
| 3 | C-MYB transcription factor network | |||||
| 4 | HIV-1 Nef: Negative effector of Fas and TNF-alpha | |||||
| 5 | Caspase Cascade in Apoptosis | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | Apoptotic cleavage of cellular proteins | |||||
| 2 | Caspase-mediated cleavage of cytoskeletal proteins | |||||
| WikiPathways | [+] 6 WikiPathways | + | ||||
| 1 | Apoptosis Modulation by HSP70 | |||||
| 2 | FAS pathway and Stress induction of HSP regulation | |||||
| 3 | Apoptosis | |||||
| 4 | Parkinsons Disease Pathway | |||||
| 5 | Apoptotic execution phase | |||||
| 6 | Apoptosis Modulation and Signaling | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | US patent application no. 6,566,135, Antisense modulation of caspase 6 expression. | |||||
| REF 2 | Synthesis and in vitro evaluation of sulfonamide isatin Michael acceptors as small molecule inhibitors of caspase-6. J Med Chem. 2009 Apr 23;52(8):2188-91. | |||||
| REF 3 | Design, synthesis, and biological evaluation of isoquinoline-1,3,4-trione derivatives as potent caspase-3 inhibitors. J Med Chem. 2006 Mar 9;49(5):1613-23. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.