Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T23714
(Former ID: TTDC00111)
|
|||||
Target Name |
B2 bradykinin receptor (BDKRB2)
|
|||||
Synonyms |
Bradykinin B2 receptor; BKR2; BK-2 receptor; BK B(2) receptor; B2R
Click to Show/Hide
|
|||||
Gene Name |
BDKRB2
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Innate/adaptive immunodeficiency [ICD-11: 4A00] | |||||
Function |
It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. Receptor for bradykinin.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP IQMENSMGTLRTSISVERQIHKLQDWAGSRQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A01105 ; BADD_A01502 ; BADD_A06794 | |||||
HIT2.0 ID | T85J2J |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | Icatibant | Drug Info | Approved | Hereditary angioedema | [2], [3], [4] | |
Clinical Trial Drug(s) | [+] 4 Clinical Trial Drugs | + | ||||
1 | Anatibant | Drug Info | Phase 2 | Traumatic brain injury | [5], [6] | |
2 | DELTIBANT | Drug Info | Phase 2 | Sepsis | [7] | |
3 | DM199 | Drug Info | Phase 2 | Ischemic stroke | [8], [9] | |
4 | Fasitibant chloride | Drug Info | Phase 2 | Osteoarthritis | [10] | |
Discontinued Drug(s) | [+] 6 Discontinued Drugs | + | ||||
1 | Labradimil | Drug Info | Discontinued in Phase 2 | Brain cancer | [11], [12] | |
2 | NPC-567 | Drug Info | Discontinued in Phase 2 | Rhinitis | [13], [14] | |
3 | CP-0597 | Drug Info | Terminated | Asthma | [15] | |
4 | FR-172357 | Drug Info | Terminated | Inflammation | [16] | |
5 | JSM-10292 | Drug Info | Terminated | Pain | [17] | |
6 | NPC-17731 | Drug Info | Terminated | Asthma | [18], [19] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Antagonist | [+] 16 Antagonist drugs | + | ||||
1 | Icatibant | Drug Info | [1], [20], [21] | |||
2 | Anatibant | Drug Info | [22], [23] | |||
3 | Fasitibant chloride | Drug Info | [25] | |||
4 | CP-0597 | Drug Info | [30] | |||
5 | FR-172357 | Drug Info | [31] | |||
6 | JSM-10292 | Drug Info | [33] | |||
7 | NPC-17731 | Drug Info | [34] | |||
8 | bradyzide | Drug Info | [36] | |||
9 | chroman 28 | Drug Info | [38] | |||
10 | FR167344 | Drug Info | [39] | |||
11 | JMV1431 | Drug Info | [26] | |||
12 | NPC-349 | Drug Info | [42] | |||
13 | PMID12723943C12 | Drug Info | [45] | |||
14 | PMID12812482C11 | Drug Info | [46] | |||
15 | PS020990 | Drug Info | [47] | |||
16 | WIN 64338 | Drug Info | [50] | |||
Modulator | [+] 3 Modulator drugs | + | ||||
1 | DELTIBANT | Drug Info | [7] | |||
2 | Breceptin | Drug Info | [37] | |||
3 | LF-160335 | Drug Info | [43] | |||
Activator | [+] 1 Activator drugs | + | ||||
1 | DM199 | Drug Info | [24] | |||
Inhibitor | [+] 11 Inhibitor drugs | + | ||||
1 | BRADYKININ | Drug Info | [26] | |||
2 | NPC-567 | Drug Info | [29] | |||
3 | FR-173657 | Drug Info | [32] | |||
4 | (D)Arg-Arg-Pro-Hyp-Gly-Phe-Ser-(d)Phe-Phe-Arg | Drug Info | [35] | |||
5 | (D)Arg-Arg-Pro-Hyp-Gly-Thi-Cys-(D)Phe-Phe-Cys-Arg | Drug Info | [35] | |||
6 | (D)Arg-Arg-Pro-Hyp-Gly-Thi-Ser-(D)Tic-Aoc-Arg | Drug Info | [35] | |||
7 | (D)Arg-Arg-Pro-Hyp-Gly-Thi-Ser-(D)Tic-Tic-Arg | Drug Info | [35] | |||
8 | H-DArg-Arg-Pro-Hyp-Gly-Igl-Ser-D-BT-OH(JMV1638) | Drug Info | [26] | |||
9 | H-Lys-Arg-Pro-Hyp-Gly-Igl-Ser-D-BT-OH(JMV1645) | Drug Info | [26] | |||
10 | H-Lys-Arg-Pro-Hyp-Gly-Thi-Ser-D-BT-OH(JMV1669) | Drug Info | [26] | |||
11 | Quinapril analogue | Drug Info | [48] | |||
Agonist | [+] 9 Agonist drugs | + | ||||
1 | Labradimil | Drug Info | [27], [28] | |||
2 | FR190997 | Drug Info | [40] | |||
3 | FR191413 | Drug Info | [41] | |||
4 | kallidin | Drug Info | [42] | |||
5 | Met-Lys-bradykinin | Drug Info | [44] | |||
6 | T-kinin | Drug Info | [49] | |||
7 | [des-Arg9]bradykinin | Drug Info | [51] | |||
8 | [Leu8,des-Arg9]bradykinin | Drug Info | [52] | |||
9 | [Sar,D-Phe8,des-Arg9]bradykinin | Drug Info | [49] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Cholesterol | Ligand Info | |||||
Structure Description | Cryo-EM structure of human bradykinin receptor BK2R in complex Gq proteins and kallidin | PDB:7F6I | ||||
Method | Electron microscopy | Resolution | 2.80 Å | Mutation | No | [53] |
PDB Sequence |
CPQVEWLGWL
56 NTIQPPFLWV66 LFVLATLENI76 FVLSVFCLHK86 SSCTVAEIYL96 GNLAAADLIL 106 ACGLPFWAIT116 ISNNFDWLFG126 ETLCRVVNAI136 ISMNLYSSIC146 FLMLVSIDRY 156 LALVKTMSMG166 RMRGVRWAKL176 YSLVIWGCTL186 LLSSPMLVFR196 TMKEYSDEGH 206 NVTACVISYP216 SLIWEVFTNM226 LLNVVGFLLP236 LSVITFCTMQ246 IMQVLRNNEM 256 QKFKEIQTER266 RATVLVLVVL276 LLFIICWLPF286 QISTFLDTLH296 RLGILSSCQD 306 ERIIDVITQI316 ASFMAYSNSC326 LNPLVYVIVG336 KRFRKKSWEV346 YQGVC |
|||||
|
LEU79
3.803
PHE82
3.421
CYS83
3.679
CYS89
3.144
GLU93
3.849
ILE94
3.871
GLY97
3.451
ASN98
3.314
ALA101
3.675
ILE105
4.301
MET139
4.947
CYS146
4.067
LEU150
3.702
ILE153
4.428
LEU157
3.597
MET165
4.957
|
|||||
Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|








KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
Calcium signaling pathway | hsa04020 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
cGMP-PKG signaling pathway | hsa04022 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Sphingolipid signaling pathway | hsa04071 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Complement and coagulation cascades | hsa04610 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
Inflammatory mediator regulation of TRP channels | hsa04750 | Affiliated Target |
![]() |
Class: Organismal Systems => Sensory system | Pathway Hierarchy | ||
Regulation of actin cytoskeleton | hsa04810 | Affiliated Target |
![]() |
Class: Cellular Processes => Cell motility | Pathway Hierarchy | ||
Endocrine and other factor-regulated calcium reabsorption | hsa04961 | Affiliated Target |
![]() |
Class: Organismal Systems => Excretory system | Pathway Hierarchy | ||
Click to Show/Hide the Information of Affiliated Human Pathways |
Degree | 3 | Degree centrality | 3.22E-04 | Betweenness centrality | 5.72E-05 |
---|---|---|---|---|---|
Closeness centrality | 2.06E-01 | Radiality | 1.36E+01 | Clustering coefficient | 3.33E-01 |
Neighborhood connectivity | 2.83E+01 | Topological coefficient | 3.46E-01 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Bradykinin receptor antagonists--a review of the patent literature 2005-2008. Expert Opin Ther Pat. 2009 Jul;19(7):919-41. | |||||
REF 2 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 667). | |||||
REF 3 | 2011 FDA drug approvals. Nat Rev Drug Discov. 2012 Feb 1;11(2):91-4. | |||||
REF 4 | Icatibant , the bradykinin B2 receptor antagonist with target to the interconnected kinin systems. Expert Opin Pharmacother. 2012 Oct;13(15):2233-47. | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 679). | |||||
REF 6 | Emerging treatments for traumatic brain injury. Expert Opin Emerg Drugs. 2009 Mar;14(1):67-84. | |||||
REF 7 | CP-0127, a novel potent bradykinin antagonist, increases survival in rat and rabbit models of endotoxin shock. Agents Actions Suppl. 1992;38 ( Pt 3):413-20. | |||||
REF 8 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 9 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 10 | ClinicalTrials.gov (NCT01091116) A Locally Injected Bradykinin Antagonist for TReatment of OSteoarthritiS. U.S. National Institutes of Health. | |||||
REF 11 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 672). | |||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006912) | |||||
REF 13 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 676). | |||||
REF 14 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002385) | |||||
REF 15 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008984) | |||||
REF 16 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008533) | |||||
REF 17 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800024715) | |||||
REF 18 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 657). | |||||
REF 19 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007977) | |||||
REF 20 | Pharmacological characterization of the bradykinin B2 receptor antagonist MEN16132 in rat in vitro bioassays. Eur J Pharmacol. 2009 Aug 1;615(1-3):10-6. | |||||
REF 21 | Bradykinin in the heart: friend or foe Circulation. 1999 Dec 7;100(23):2305-7. | |||||
REF 22 | Inhibition of bradykinin B2 receptors before, not after onset of experimental subarachnoid hemorrhage prevents brain edema formation and improves functional outcome. Crit Care Med. 2009 Jul;37(7):2228-34. | |||||
REF 23 | Anatibant, a selective non-peptide bradykinin B2 receptor antagonist, reduces intracranial hypertension and histopathological damage after experime... Neurosci Lett. 2009 Apr 24;454(2):115-7. | |||||
REF 24 | Pharmacological effects of recombinant human tissue kallikrein on bradykinin B2 receptors. Pharmacol Res Perspect. 2015 Mar;3(2):e00119. | |||||
REF 25 | Fasitibant chloride, a kinin B receptor antagonist, and dexamethasone interact to inhibit carrageenan-induced inflammatory arthritis in rats. Br J Pharmacol. 2012 Jun;166(4):1403-10. | |||||
REF 26 | Synthesis and biological evaluation of bradykinin B(1)/B(2) and selective B(1) receptor antagonists. J Med Chem. 2000 Jun 15;43(12):2382-6. | |||||
REF 27 | Metabolically stable bradykinin B2 receptor agonists enhance transvascular drug delivery into malignant brain tumors by increasing drug half-life. J Transl Med. 2009 May 13;7:33. | |||||
REF 28 | Bradykinin receptor agonist facilitates low-dose cyclosporine-A protection against 6-hydroxydopamine neurotoxicity. Brain Res. 2002 Nov 29;956(2):211-20. | |||||
REF 29 | cis-4-(Piperazin-1-yl)-5,6,7a,8,9,10,11,11a-octahydrobenzofuro[2,3-h]quinazolin-2-amine (A-987306), a new histamine H4R antagonist that blocks pain... J Med Chem. 2008 Nov 27;51(22):7094-8. | |||||
REF 30 | CP-0597, a selective bradykinin B2 receptor antagonist, inhibits brain injury in a rat model of reversible middle cerebral artery occlusion. Stroke. 1997 Jul;28(7):1430-6. | |||||
REF 31 | Characterization of FR 172357, a new non-peptide bradykinin B(2) receptor antagonist, in human, pig and rabbit preparations. Eur J Pharmacol. 1999 Dec 10;386(1):25-31. | |||||
REF 32 | Novel small molecule bradykinin B2 receptor antagonists. J Med Chem. 2009 Jul 23;52(14):4370-9. | |||||
REF 33 | Binding characteristics of [3H]-JSM10292: a new cell membrane-permeant non-peptide bradykinin B2 receptor antagonist. Br J Pharmacol. 2012 Oct;167(4):839-53. | |||||
REF 34 | Antinociceptive profile of the pseudopeptide B2 bradykinin receptor antagonist NPC 18688 in mice. Br J Pharmacol. 1996 Feb;117(3):552-558. | |||||
REF 35 | Design and conformational analysis of several highly potent bradykinin receptor antagonists. J Med Chem. 1991 Mar;34(3):1230-3. | |||||
REF 36 | Bradyzide, a potent non-peptide B(2) bradykinin receptor antagonist with long-lasting oral activity in animal models of inflammatory hyperalgesia. Br J Pharmacol. 2000 Jan;129(1):77-86. | |||||
REF 37 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 42). | |||||
REF 38 | Identification of a nonpeptidic and conformationally restricted bradykinin B1 receptor antagonist with anti-inflammatory activity. J Med Chem. 2007 Feb 22;50(4):607-10. | |||||
REF 39 | Novel subtype-selective nonpeptide bradykinin receptor antagonists FR167344 and FR173657. Mol Pharmacol. 1997 Feb;51(2):171-6. | |||||
REF 40 | Nonpeptide mimic of bradykinin with long-acting properties at the bradykinin B2 receptor. Mol Pharmacol. 1997 Jul;52(1):16-20. | |||||
REF 41 | Discovery of the first non-peptide full agonists for the human bradykinin B(2) receptor incorporating 4-(2-picolyloxy)quinoline and 1-(2-picolyl)benzimidazole frameworks. J Med Chem. 2004 May 20;47(11):2853-63. | |||||
REF 42 | Differential pharmacology of cloned human and mouse B2 bradykinin receptors. Mol Pharmacol. 1994 Jan;45(1):1-8. | |||||
REF 43 | The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954. | |||||
REF 44 | Expression cloning of a human B1 bradykinin receptor. J Biol Chem. 1994 Aug 26;269(34):21583-6. | |||||
REF 45 | Benzodiazepines as potent and selective bradykinin B1 antagonists. J Med Chem. 2003 May 8;46(10):1803-6. | |||||
REF 46 | Discovery of a potent, non-peptide bradykinin B1 receptor antagonist. J Am Chem Soc. 2003 Jun 25;125(25):7516-7. | |||||
REF 47 | Small molecule antagonists of the bradykinin B1 receptor. Immunopharmacology. 1999 Sep;43(2-3):169-77. | |||||
REF 48 | Ace inhibitors as a template for the design of bradykinin B2 receptor antagonists, Bioorg. Med. Chem. Lett. 5(4):367-370 (1995). | |||||
REF 49 | Molecular characterisation of cloned bradykinin B1 receptors from rat and human. Eur J Pharmacol. 1999 Jun 25;374(3):423-33. | |||||
REF 50 | Design of potent non-peptide competitive antagonists of the human bradykinin B2 receptor. J Med Chem. 1993 Aug 20;36(17):2583-4. | |||||
REF 51 | Stable expression of human kinin B1 receptor in 293 cells: pharmacological and functional characterization. Br J Pharmacol. 1997 Sep;122(2):393-9. | |||||
REF 52 | Partial agonists and full antagonists at the human and murine bradykinin B1 receptors. Can J Physiol Pharmacol. 1997 Jun;75(6):735-40. | |||||
REF 53 | Cryo-EM structures of human bradykinin receptor-G(q) proteins complexes. Nat Commun. 2022 Feb 7;13(1):714. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.