Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T23519
|
|||||
| Target Name |
G-protein coupled receptor C 5D (GPRC5D)
|
|||||
| Gene Name |
GPRC5D
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Multiple myeloma [ICD-11: 2A83] | |||||
| Function |
extracellular exosome, intracellular membrane-bounded organelle, plasma membrane, receptor complex, protein kinase activator activity
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MYKDCIESTGDYFLLCDAEGPWGIILESLAILGIVVTILLLLAFLFLMRKIQDCSQWNVL
PTQLLFLLSVLGLFGLAFAFIIELNQQTAPVRYFLFGVLFALCFSCLLAHASNLVKLVRG CVSFSWTTILCIAIGCSLLQIIIATEYVTLIMTRGMMFVNMTPCQLNVDFVVLLVYVLFL MALTFFVSKATFCGPCENWKQHGRLIFITVLFSIIIWVVWISMLLRGNPQFQRQPQWDDP VVCIALVTNAWVFLLLYIVPELCILYRSCRQECPLQGNACPVTAYQHSFQVENQELSRAR DSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Talquetamab | Drug Info | Approved | Multiple myeloma | [1] | |
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | GPRC5D CAR-T cell therapy | Drug Info | Phase 1 | Multiple myeloma | [2] | |
| 2 | RG6234 | Drug Info | Phase 1 | Multiple myeloma | [3] | |
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | FDA Approved Drug Products from FDA Official Website. 2023. Application Number: 761342 | |||||
| REF 2 | Clinical pipeline report, company report or official report of Bristol-Myers Squibb. | |||||
| REF 3 | Clinical pipeline report, company report or official report of Roche | |||||
| REF 4 | GPRC5D is a target for the immunotherapy of multiple myeloma with rationally designed CAR T cells. Sci Transl Med. 2019 Mar 27;11(485):eaau7746. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.