Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T20978
(Former ID: TTDI01957)
|
|||||
| Target Name |
T-cell surface glycoprotein CD8 (CD8)
|
|||||
| Synonyms |
T-lymphocyte differentiation antigen T8/Leu-2; CD8
Click to Show/Hide
|
|||||
| Gene Name |
CD8A; CD8B
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 3 Target-related Diseases | + | ||||
| 1 | Influenza [ICD-11: 1E30-1E32] | |||||
| 2 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| 3 | Human immunodeficiency virus disease [ICD-11: 1C60-1C62] | |||||
| Function |
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN SIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFA CDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 3 Clinical Trial Drugs | + | ||||
| 1 | Fluoropeptide vaccine | Drug Info | Phase 2 | Influenza virus infection | [2] | |
| 2 | Anti-VEGFR2 CD8 cell therapy | Drug Info | Phase 1/2 | Solid tumour/cancer | [3] | |
| 3 | LIPO-4 | Drug Info | Phase 1 | Human immunodeficiency virus infection | [4] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Anti-VEGFR2 CD8 cell therapy | Drug Info | [3], [5] | |||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 5 KEGG Pathways | + | ||||
| 1 | Cell adhesion molecules (CAMs) | |||||
| 2 | Antigen processing and presentation | |||||
| 3 | Hematopoietic cell lineage | |||||
| 4 | T cell receptor signaling pathway | |||||
| 5 | Primary immunodeficiency | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | A novel peptide-based pan-influenza A vaccine: a double blind, randomised clinical trial of immunogenicity and safety. Vaccine. 2015 Jan 3;33(2):396-402. | |||||
| REF 2 | ClinicalTrials.gov (NCT01703923) An Exploratory Study of FP01 Lozenges in Subjects With Chronic Refractory Cough. U.S. National Institutes of Health. | |||||
| REF 3 | ClinicalTrials.gov (NCT01218867) CAR T Cell Receptor Immunotherapy Targeting VEGFR2 for Patients With Metastatic Cancer. U.S. National Institutes of Health. | |||||
| REF 4 | ClinicalTrials.gov (NCT00121121) Safety of Intradermal Versus Intramuscular Administration of HIV Lipopeptides in HIV Uninfected Adult Volunteers. U.S. National Institutes of Health. | |||||
| REF 5 | Vascular normalizing doses of antiangiogenic treatment reprogram the immunosuppressive tumor microenvironment and enhance immunotherapy. Proc Natl Acad Sci U S A. 2012 Oct 23;109(43):17561-6. | |||||
| REF 6 | Long-term CD4(+) and CD8(+) T-cell responses induced in HIV-uninfected volunteers following intradermal or intramuscular administration of an HIV-lipopeptide vaccine (ANRS VAC16). Vaccine. 2013 Sep 13;31(40):4406-15. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.