Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T20251
(Former ID: TTDS00147)
|
|||||
Target Name |
Voltage-gated potassium channel Kv11.1 (KCNH2)
|
|||||
Synonyms |
hERG1; hERG-1; Voltage-gated potassium channel subunit Kv11.1; Potassium voltage-gated channel subfamily H member 2; HERG K+ channel; HERG; H-ERG; Ether-a-go-go-related protein 1; Ether-a-go-go-related gene potassium channel 1; Ether-a-go-go related protein 1; Ether-a-go-go related gene potassium channel 1; Eag related protein 1; Eag homolog; ERG-1; ERG
|
|||||
Gene Name |
KCNH2
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Heart failure [ICD-11: BD10-BD1Z] | |||||
Function |
Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr). Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel.
Click to Show/Hide
|
|||||
BioChemical Class |
Voltage-gated ion channel
|
|||||
UniProt ID | ||||||
Sequence |
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG AVIMFILNFEVVMEKDMVGSPAHDTNHRGPPTSWLAPGRAKTFRLKLPALLALTARESSV RSGGAGGAGAPGAVVVDVDLTPAAPSSESLALDEVTAMDNHVAGLGPAEERRALVGPGSP PRSAPGQLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGVLPPPP RHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDREIIA PKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLLVIY TAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANE EVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVARKLD RYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPYNSS GLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVS AIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGF PECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALY FISRGSIEILRGDVVVAILGKNDIFGEPLNLYARPGKSNGDVRALTYCDLHKIHRDDLLE VLDMYPEFSDHFWSSLEITFNLRDTNMIPGSPGSTELEGGFSRQRKRKLSFRRRTDKDTE QPGEVSALGPGRAGAGPSSRGRPGGPWGESPSSGPSSPESSEDEGPGRSSSPLRLVPFSS PRPPGEPPGGEPLMEDCEKSSDTCNPLSGAFSGVSNIFSFWGDSRGRQYQELPRCPAPTP SLLNIPLSSPGRRPRGDVESRLDALQRQLNRLETRLSADMATVLQLLQRQMTLVPPAYSA VTTPGPGPTSTSPLLPVSPLPTLTLDSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPG QLGALTSQPLHRHGSDPGS Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
ADReCS ID | BADD_A04352 ; BADD_A04830 | |||||
HIT2.0 ID | T59P8I |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
1 | VESNARINONE | Drug Info | Approved | Cardiac failure | [2] | |
Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
1 | M100907 | Drug Info | Phase 3 | Sleep-wake disorder | [3] | |
2 | ABT-229 | Drug Info | Phase 2 | Pain | [4], [5] | |
3 | HP-184 | Drug Info | Phase 2 | Multiple sclerosis | [6] | |
4 | NITD609 | Drug Info | Phase 2 | Malaria | [7] | |
5 | ISOQUINE | Drug Info | Phase 1 | Malaria | [8] | |
Discontinued Drug(s) | [+] 3 Discontinued Drugs | + | ||||
1 | MK-499 | Drug Info | Discontinued in Phase 2 | Cardiac arrhythmias | [9], [10] | |
2 | Bertosamil | Drug Info | Terminated | Angina pectoris | [11] | |
3 | L-702958 | Drug Info | Terminated | Cardiac arrhythmias | [12] | |
Mode of Action | [+] 7 Modes of Action | + | ||||
Inhibitor | [+] 69 Inhibitor drugs | + | ||||
1 | VESNARINONE | Drug Info | [1] | |||
2 | M100907 | Drug Info | [13] | |||
3 | ABT-229 | Drug Info | [14] | |||
4 | NITD609 | Drug Info | [15] | |||
5 | ISOQUINE | Drug Info | [16] | |||
6 | Pyrido[3,2-e][1,2,4]triazolo[4,3-a]pyrazine derivative 1 | Drug Info | [18] | |||
7 | Pyrido[3,2-e][1,2,4]triazolo[4,3-a]pyrazine derivative 2 | Drug Info | [18] | |||
8 | MK-499 | Drug Info | [20] | |||
9 | (1R,5R)-30-OXO-19-OXA-2,6,10,12-TETRAAZAHEXACYCLO[18.6.2.1^{2,5}.1^{14,18}.0^{8,12}.0^{23,27}]TRIACONTA-8,10,14(29),15,17,20(28),21,23(27)-OCTAENE-17-CARBONITRILE (STRUCTURAL MIX) | Drug Info | [22] | |||
10 | (2R)-N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-2-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [23] | |||
11 | (E)-2-(4-fluorostyryl)-5-(phenylsulfinyl)pyridine | Drug Info | [24] | |||
12 | (R)-3-(naphthalen-2-ylmethoxy)pyrrolidine | Drug Info | [25] | |||
13 | (R)-6-(2-(2-methylpyrrolidin-1-yl)ethyl)quinoline | Drug Info | [26] | |||
14 | (R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide | Drug Info | [27] | |||
15 | (R)-ONDANSETRON | Drug Info | [28] | |||
16 | (S)-3-(naphthalen-2-ylmethoxy)pyrrolidine | Drug Info | [25] | |||
17 | 1,6-bis(4-(3-chlorophenyl)piperazin-1-yl)hexane | Drug Info | [29] | |||
18 | 1,6-bis(4-(3-methoxyphenyl)piperazin-1-yl)hexane | Drug Info | [29] | |||
19 | 1,6-bis(4-m-tolylpiperazin-1-yl)hexane | Drug Info | [29] | |||
20 | 1,6-bis(4-phenylpiperazin-1-yl)hexane | Drug Info | [29] | |||
21 | 1-(1-(2-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [30] | |||
22 | 1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [30] | |||
23 | 1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine | Drug Info | [30] | |||
24 | 1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX) | Drug Info | [30] | |||
25 | 1-(2-(6-fluoronaphthalen-2-yl)ethyl)piperazine | Drug Info | [25] | |||
26 | 1-(4-p-Tolyl-butyl)-piperidine | Drug Info | [31] | |||
27 | 2-Phenyl-3-piperidin-3-yl-1H-indole | Drug Info | [32] | |||
28 | 2-Phenyl-3-piperidin-4-yl-1H-indole | Drug Info | [32] | |||
29 | 2-[4-(2-Piperidin-1-ylethyl)phenoxy]benzothiazole | Drug Info | [33] | |||
30 | 3 9-DIHYDRO-N-DESMETHYL-N-ISOPROPYLERYTHROMYCIN A | Drug Info | [14] | |||
31 | 3-(1-Benzyl-piperidin-3-yl)-2-phenyl-1H-indole | Drug Info | [32] | |||
32 | 3-(1-Methyl-piperidin-2-yl)-2-phenyl-1H-indole | Drug Info | [32] | |||
33 | 3-(1-Methyl-piperidin-3-yl)-2-phenyl-1H-indole | Drug Info | [32] | |||
34 | 3-(1-Phenethyl-piperidin-3-yl)-2-phenyl-1H-indole | Drug Info | [32] | |||
35 | 3-(1-Phenethyl-piperidin-4-yl)-2-phenyl-1H-indole | Drug Info | [32] | |||
36 | 3-(1H-indol-3-yl)-N-methyl-3-phenylpropan-1-amine | Drug Info | [34] | |||
37 | 3-(benzo[b]thiophen-5-yl)-3-benzylpyrrolidine | Drug Info | [34] | |||
38 | 3-(dimethylamino)-1-(4-heptylphenyl)propan-1-one | Drug Info | [35] | |||
39 | 4-((naphthalen-2-yloxy)methyl)piperidine | Drug Info | [25] | |||
40 | 4-(2-thienyl)benzene-1,2-diamine | Drug Info | [36] | |||
41 | 4-(3-thienyl)benzene-1,2-diamine) | Drug Info | [36] | |||
42 | 4-(p-Tolyl)spiro[chromene-2,4'-piperidine] | Drug Info | [37] | |||
43 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)benzamide | Drug Info | [38] | |||
44 | 4-(Spiro[chromene-2,4'-piperidine]-4-yl)phenol | Drug Info | [37] | |||
45 | 4-Benzenesulfonyl-1-(3-phenyl-propyl)-piperidine | Drug Info | [39] | |||
46 | 4-Benzenesulfonyl-1-phenethyl-piperidine | Drug Info | [39] | |||
47 | 4-Phenylspiro[chromene-2,4'-piperidine] | Drug Info | [37] | |||
48 | 5-(3-(4-fluorobenzyl)pyrrolidin-3-yl)-1H-indole | Drug Info | [34] | |||
49 | 5-(3-benzylpyrrolidin-3-yl)-1-methyl-1H-indole | Drug Info | [34] | |||
50 | 5-(3-benzylpyrrolidin-3-yl)-1h-indole (structural mix) | Drug Info | [34] | |||
51 | 5-(3-butylpyrrolidin-3-yl)-1H-indole | Drug Info | [34] | |||
52 | 5-Chloro-3-ethyl-1-(4-fluoro-phenyl)-1H-indole | Drug Info | [20] | |||
53 | 6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-N-(HYDROXYMETHYL)-1,2,2-TRIMETHYL-1,2,3,4-TETRAHYDRO-1,8-NAPHTHYRIDINE-4-CARBOXAMIDE (ENANTIOMERIC MIX) | Drug Info | [23] | |||
54 | 7-(piperidin-4-ylmethoxy)-2-naphthonitrile | Drug Info | [25] | |||
55 | 8-azabicyclo[3.2.1]octan-3-yloxy-benzamide | Drug Info | [40] | |||
56 | ADS-103253 | Drug Info | [42] | |||
57 | BMS-645737 | Drug Info | [43] | |||
58 | DESMETHYLOLANZAPINE | Drug Info | [22] | |||
59 | GW803430 | Drug Info | [46] | |||
60 | JNJ-10392980 | Drug Info | [33] | |||
61 | MDL-74156 | Drug Info | [1] | |||
62 | MK-1925 | Drug Info | [49] | |||
63 | N-(4-(benzyloxy)phenethyl)pyridin-4-amine | Drug Info | [50] | |||
64 | N-(6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDIN-4-YL)-3-HYDROXYPROPANAMIDE (ENANTIOMERIC MIX) | Drug Info | [23] | |||
65 | N-(piperidin-4-yl)-N-propyl-2-naphthamide | Drug Info | [27] | |||
66 | N-[6-(4-CHLOROPHENYL)-7-(2,4-DICHLOROPHENYL)-2,2-DIMETHYL-3,4-DIHYDRO-2H-PYRANO[2,3-B]PYRIDINE-4-YL]-4,4,4-TRIFLUORO-3-HYDROXYBUTANAMIDE (DIASTEREOMERIC MIX) | Drug Info | [51] | |||
67 | PF-526014 | Drug Info | [30] | |||
68 | R-dimethindene | Drug Info | [55] | |||
69 | [1-(4-p-Tolyl-butyl)-piperidin-4-yl]-methanol | Drug Info | [31] | |||
Blocker | [+] 2 Blocker drugs | + | ||||
1 | HP-184 | Drug Info | [6] | |||
2 | Desmethylastemizole | Drug Info | [1], [44] | |||
Ligand | [+] 5 Ligand drugs | + | ||||
1 | Isoindoline derivative 1 | Drug Info | [17] | |||
2 | Isoindoline derivative 2 | Drug Info | [17] | |||
3 | Isoindoline derivative 3 | Drug Info | [17] | |||
4 | Isoindoline derivative 4 | Drug Info | [17] | |||
5 | Isoindoline derivative 5 | Drug Info | [17] | |||
Antagonist | [+] 3 Antagonist drugs | + | ||||
1 | Quinoline derivative 11 | Drug Info | [19] | |||
2 | Quinoline derivative 12 | Drug Info | [19] | |||
3 | Quinoline derivative 13 | Drug Info | [19] | |||
Modulator | [+] 2 Modulator drugs | + | ||||
1 | Bertosamil | Drug Info | [11] | |||
2 | L-702958 | Drug Info | [21] | |||
Activator | [+] 8 Activator drugs | + | ||||
1 | A-935142 | Drug Info | [41] | |||
2 | ginsenoside Rg3 | Drug Info | [45] | |||
3 | ICA-105574 | Drug Info | [47] | |||
4 | KB-130015 | Drug Info | [48] | |||
5 | PD-118057 | Drug Info | [53] | |||
6 | PD-307243 | Drug Info | [54] | |||
7 | RPR260243 | Drug Info | [56] | |||
8 | VU0405601 | Drug Info | [57] | |||
Opener | [+] 1 Opener drugs | + | ||||
1 | NS-1643 | Drug Info | [52] |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
Pathwhiz Pathway | [+] 1 Pathwhiz Pathways | + | ||||
1 | Muscle/Heart Contraction | |||||
Reactome | [+] 1 Reactome Pathways | + | ||||
1 | Voltage gated Potassium channels | |||||
WikiPathways | [+] 3 WikiPathways | + | ||||
1 | SIDS Susceptibility Pathways | |||||
2 | Hematopoietic Stem Cell Differentiation | |||||
3 | Potassium Channels |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Prediction of hERG potassium channel affinity by traditional and hologram qSAR methods. Bioorg Med Chem Lett. 2003 Aug 18;13(16):2773-5. | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 3 | ClinicalTrials.gov (NCT00495885) Efficacy and Safety of M100907 on Sleep Maintenance Insomnia With a Sub-study in Stable Type II Diabetes Mellitus. U.S. National Institutes of Health. | |||||
REF 4 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 1444). | |||||
REF 5 | GSK962040: a small molecule, selective motilin receptor agonist, effective as a stimulant of human and rabbit gastrointestinal motility. Neurogastroenterol Motil. 2009 Jun;21(6):657-64, e30-1. | |||||
REF 6 | Emerging drugs for spinal cord injury. Expert Opin Emerg Drugs. 2008 Mar;13(1):63-80. | |||||
REF 7 | ClinicalTrials.gov (NCT01836458) A Study to Find the Minimum Inhibitory Concentration of KAE609 in Adult Male Patients With P. Falciparum Monoinfection. U.S. National Institutes of Health. | |||||
REF 8 | Antimalarial activity of isoquine against Kenyan Plasmodium falciparum clinical isolates and association with polymorphisms in pfcrt and pfmdr1 genes. J Antimicrob Chemother. 2013 Apr;68(4):786-8. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2607). | |||||
REF 10 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002963) | |||||
REF 11 | Bertosamil blocks HERG potassium channels in their open and inactivated states. Br J Pharmacol. 2002 Sep;137(2):221-8. | |||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002728) | |||||
REF 13 | Non-basic ligands for aminergic GPCRs: the discovery and development diaryl sulfones as selective, orally bioavailable 5-HT2A receptor antagonists ... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3708-12. | |||||
REF 14 | 9-Dihydroerythromycin ethers as motilin agonists--developing structure-activity relationships for potency and safety. Bioorg Med Chem. 2010 Nov 1;18(21):7651-8. | |||||
REF 15 | Spiroindolones, a potent compound class for the treatment of malaria. Science. 2010 Sep 3;329(5996):1175-80. | |||||
REF 16 | Candidate selection and preclinical evaluation of N-tert-butyl isoquine (GSK369796), an affordable and effective 4-aminoquinoline antimalarial for ... J Med Chem. 2009 Mar 12;52(5):1408-15. | |||||
REF 17 | The sigma-2 (-2) receptor: a review of recent patent applications: 2013-2018.Expert Opin Ther Pat. 2018 Sep;28(9):655-663. | |||||
REF 18 | Towards selective phosphodiesterase 2A (PDE2A) inhibitors: a patent review (2010 - present).Expert Opin Ther Pat. 2016 Aug;26(8):933-46. | |||||
REF 19 | P2X7 receptor antagonists: a patent review (2010-2015).Expert Opin Ther Pat. 2017 Mar;27(3):257-267. | |||||
REF 20 | Characterization of HERG potassium channel inhibition using CoMSiA 3D QSAR and homology modeling approaches. Bioorg Med Chem Lett. 2003 May 19;13(10):1829-35. | |||||
REF 21 | Analogs of MK-499 are differentially affected by a mutation in the S6 domain of the hERG K+ channel.Biochem Pharmacol.2009 May 15;77(10):1602-11. | |||||
REF 22 | Side chain flexibilities in the human ether-a-go-go related gene potassium channel (hERG) together with matched-pair binding studies suggest a new ... J Med Chem. 2009 Jul 23;52(14):4266-76. | |||||
REF 23 | Dihydro-pyrano[2,3-b]pyridines and tetrahydro-1,8-naphthyridines as CB1 receptor inverse agonists: synthesis, SAR and biological evaluation. Bioorg Med Chem Lett. 2010 Jun 15;20(12):3750-4. | |||||
REF 24 | 2,5-Disubstituted pyridines: the discovery of a novel series of 5-HT2A ligands. Bioorg Med Chem Lett. 2007 May 1;17(9):2643-8. | |||||
REF 25 | Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32. | |||||
REF 26 | In vitro studies on a class of quinoline containing histamine H3 antagonists. Bioorg Med Chem Lett. 2010 Jun 1;20(11):3295-300. | |||||
REF 27 | Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2. | |||||
REF 28 | A binary QSAR model for classification of hERG potassium channel blockers. Bioorg Med Chem. 2008 Apr 1;16(7):4107-19. | |||||
REF 29 | Discovery of bishomo(hetero)arylpiperazines as novel multifunctional ligands targeting dopamine D(3) and serotonin 5-HT(1A) and 5-HT(2A) receptors. J Med Chem. 2010 Jun 24;53(12):4803-7. | |||||
REF 30 | Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reduc... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92. | |||||
REF 31 | Structural determinants for histamine H(1) affinity, hERG affinity and QTc prolongation in a series of terfenadine analogs. Bioorg Med Chem Lett. 2009 Sep 1;19(17):5043-7. | |||||
REF 32 | 3-(4-Fluoropiperidin-3-yl)-2-phenylindoles as high affinity, selective, and orally bioavailable h5-HT(2A) receptor antagonists. J Med Chem. 2001 May 10;44(10):1603-14. | |||||
REF 33 | Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69. | |||||
REF 34 | Novel 3,3-disubstituted pyrrolidines as selective triple serotonin/norepinephrine/dopamine reuptake inhibitors. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6062-6. | |||||
REF 35 | Improvement of pharmacological properties of irreversible thyroid receptor coactivator binding inhibitors. J Med Chem. 2009 Jul 9;52(13):3892-901. | |||||
REF 36 | Parallel medicinal chemistry approaches to selective HDAC1/HDAC2 inhibitor (SHI-1:2) optimization. Bioorg Med Chem Lett. 2009 Feb 15;19(4):1168-72. | |||||
REF 37 | Potent, orally bioavailable delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-4-(5-hydroxyspiro[chromene-2,4'-pipe... J Med Chem. 2008 Oct 9;51(19):5893-6. | |||||
REF 38 | Spirocyclic delta opioid receptor agonists for the treatment of pain: discovery of N,N-diethyl-3-hydroxy-4-(spiro[chromene-2,4'-piperidine]-4-yl) b... J Med Chem. 2009 Sep 24;52(18):5685-702. | |||||
REF 39 | 4-(Phenylsulfonyl)piperidines: novel, selective, and bioavailable 5-HT(2A) receptor antagonists. J Med Chem. 2002 Jan 17;45(2):492-503. | |||||
REF 40 | SAR development of a series of 8-azabicyclo[3.2.1]octan-3-yloxy-benzamides as kappa opioid receptor antagonists. Part 2. Bioorg Med Chem Lett. 2010 Sep 15;20(18):5405-10. | |||||
REF 41 | Electrophysiologic characterization of a novel hERG channel activator. Biochem Pharmacol. 2009 Apr 15;77(8):1383-90. | |||||
REF 42 | Quinazoline and benzimidazole MCH-1R antagonists. Bioorg Med Chem Lett. 2007 Mar 1;17(5):1403-7. | |||||
REF 43 | Discovery and preclinical studies of 5-isopropyl-6-(5-methyl-1,3,4-oxadiazol-2-yl)-N-(2-methyl-1H-pyrrolo[2,3-b]pyridin-5-yl)pyrrolo[2,1-f][1,2,4]t... Bioorg Med Chem Lett. 2008 May 1;18(9):2985-9. | |||||
REF 44 | Block of HERG potassium channels by the antihistamine astemizole and its metabolites desmethylastemizole and norastemizole. J Cardiovasc Electrophysiol. 1999 Jun;10(6):836-43. | |||||
REF 45 | Ginsenoside Rg(3) decelerates hERG K(+) channel deactivation through Ser631 residue interaction. Eur J Pharmacol. 2011 Aug 1;663(1-3):59-67. | |||||
REF 46 | Novel approach for chemotype hopping based on annotated databases of chemically feasible fragments and a prospective case study: new melanin concen... J Med Chem. 2009 Apr 9;52(7):2076-89. | |||||
REF 47 | Pharmacological removal of human ether- -go-go-related gene potassium channel inactivation by 3-nitro-N-(4-phenoxyphenyl) benzamide (ICA-105574). Mol Pharmacol. 2010 Jan;77(1):58-68. | |||||
REF 48 | The amiodarone derivative KB130015 activates hERG1 potassium channels via a novel mechanism. Eur J Pharmacol. 2010 Apr 25;632(1-3):52-9. | |||||
REF 49 | Identification of MK-1925: a selective, orally active and brain-penetrable opioid receptor-like 1 (ORL1) antagonist. Bioorg Med Chem Lett. 2009 Aug 15;19(16):4729-32. | |||||
REF 50 | Identification and characterization of 4-methylbenzyl 4-[(pyrimidin-2-ylamino)methyl]piperidine-1-carboxylate, an orally bioavailable, brain penetr... J Med Chem. 2007 Feb 22;50(4):807-19. | |||||
REF 51 | Discovery of N-[(4R)-6-(4-chlorophenyl)-7-(2,4-dichlorophenyl)-2,2-dimethyl-3,4-dihydro-2H-pyrano[2,3-b]pyridin-4-yl]-5-methyl-1H-pyrazole-3-carbox... J Med Chem. 2010 May 27;53(10):4028-37. | |||||
REF 52 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 572). | |||||
REF 53 | Novel potent human ether-a-go-go-related gene (hERG) potassium channel enhancers and their in vitro antiarrhythmic activity. Mol Pharmacol. 2005 Sep;68(3):876-84. | |||||
REF 54 | 2-[2-(3,4-dichloro-phenyl)-2,3-dihydro-1H-isoindol-5-ylamino]-nicotinic acid (PD-307243) causes instantaneous current through human ether-a-go-go-r... Mol Pharmacol. 2008 Mar;73(3):639-51. | |||||
REF 55 | Characterization of novel selective H1-antihistamines for clinical evaluation in the treatment of insomnia. J Med Chem. 2009 Sep 10;52(17):5307-10. | |||||
REF 56 | Discovery of a small molecule activator of the human ether-a-go-go-related gene (HERG) cardiac K+ channel. Mol Pharmacol. 2005 Mar;67(3):827-36. | |||||
REF 57 | Identification and characterization of a compound that protects cardiac tissue from human Ether- -go-go-related gene (hERG)-related drug-induced arrhythmias. J Biol Chem. 2012 Nov 16;287(47):39613-25. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.