Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T16340
(Former ID: TTDI01935)
|
|||||
Target Name |
Interleukin-1 alpha (IL1A)
|
|||||
Synonyms |
IL1F1; IL-1 alpha; Hematopoietin-1
Click to Show/Hide
|
|||||
Gene Name |
IL1A
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Colorectal cancer [ICD-11: 2B91] | |||||
2 | Influenza [ICD-11: 1E30-1E32] | |||||
Function |
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Click to Show/Hide
|
|||||
BioChemical Class |
Cytokine: interleukin
|
|||||
UniProt ID | ||||||
Sequence |
MAKVPDMFEDLKNCYSENEEDSSSIDHLSLNQKSFYHVSYGPLHEGCMDQSVSLSISETS
KTSKLTFKESMVVVATNGKVLKKRRLSLSQSITDDDLEAIANDSEEEIIKPRSAPFSFLS NVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKI TVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHP NLFIATKQDYWVCLAGGPPSITDFQILENQA Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
ADReCS ID | BADD_A00752 ; BADD_A03065 ; BADD_A05322 ; BADD_A05823 | |||||
HIT2.0 ID | T34HYH |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 5 Clinical Trial Drugs | + | ||||
1 | MABp1 | Drug Info | Phase 3 | Colorectal cancer | [2] | |
2 | Xilonix | Drug Info | Phase 3 | Influenza virus infection | [3] | |
3 | ABT-981 | Drug Info | Phase 2 | Osteoarthritis | [4], [5] | |
4 | Bermekimab | Drug Info | Phase 2 | Hidradenitis suppurativa | [6] | |
5 | Natrunix | Drug Info | Phase 2 | Arthritis | [7] | |
Discontinued Drug(s) | [+] 2 Discontinued Drugs | + | ||||
1 | IX207-887 | Drug Info | Discontinued in Phase 2 | Rheumatoid arthritis | [8] | |
2 | IL1aQb | Drug Info | Terminated | Arteriosclerosis | [9] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 2 Inhibitor drugs | + | ||||
1 | MABp1 | Drug Info | [10] | |||
2 | Natrunix | Drug Info | [7] | |||
Modulator | [+] 4 Modulator drugs | + | ||||
1 | Xilonix | Drug Info | [11] | |||
2 | ABT-981 | Drug Info | [1] | |||
3 | IX207-887 | Drug Info | [13], [14] | |||
4 | Interleukin-1-alpha - Amgen/Roche | Drug Info | [16] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Pathway Affiliation
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
MAPK signaling pathway | hsa04010 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Cytokine-cytokine receptor interaction | hsa04060 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy | ||
Necroptosis | hsa04217 | Affiliated Target |
![]() |
Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
Cellular senescence | hsa04218 | Affiliated Target |
![]() |
Class: Cellular Processes => Cell growth and death | Pathway Hierarchy | ||
Osteoclast differentiation | hsa04380 | Affiliated Target |
![]() |
Class: Organismal Systems => Development and regeneration | Pathway Hierarchy | ||
Hematopoietic cell lineage | hsa04640 | Affiliated Target |
![]() |
Class: Organismal Systems => Immune system | Pathway Hierarchy | ||
Click to Show/Hide the Information of Affiliated Human Pathways |
Degree | 27 | Degree centrality | 2.90E-03 | Betweenness centrality | 3.72E-04 |
---|---|---|---|---|---|
Closeness centrality | 2.29E-01 | Radiality | 1.40E+01 | Clustering coefficient | 4.50E-01 |
Neighborhood connectivity | 2.90E+01 | Topological coefficient | 9.51E-02 | Eccentricity | 11 |
Download | Click to Download the Full PPI Network of This Target | ||||
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Generation and characterization of ABT-981, a dual variable domain immunoglobulin (DVD-Ig(TM)) molecule that specifically and potently neutralizes both IL-1alpha and IL-1beta. MAbs. 2015;7(3):605-19. | |||||
REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 3 | Clinical pipeline report, company report or official report of Xbiotech. | |||||
REF 4 | ClinicalTrials.gov (NCT02087904) A Phase 2a Study Evaluating the Safety, Efficacy, and Pharmacodynamic Effects of ABT-981 in Patients With Knee Osteoarthritis | |||||
REF 5 | ClinicalTrials.gov (NCT02384538) A Phase 2a Study Evaluating the Safety and Efficacy of ABT-981 in Patients With Erosive Hand Osteoarthritis | |||||
REF 6 | ClinicalTrials.gov (NCT03512275) A Phase II, Open Label Study of Bermekimab in Patients With Moderate to Severe Hidradenitis Suppurativa. U.S.National Institutes of Health. | |||||
REF 7 | ClinicalTrials.gov (NCT05363917) Phase II Double-Blinded, Placebo-Controlled Randomized Study Examining the Safety and Efficacy of Natrunix Versus Methotrexate (+Folate) for the Treatment of Rheumatoid Arthritis. U.S.National Institutes of Health. | |||||
REF 8 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002363) | |||||
REF 9 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800021743) | |||||
REF 10 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 11 | Clinical pipeline report, company report or official report of xbiotech. | |||||
REF 12 | Target molecules for future hidradenitis suppurativa treatment. Exp Dermatol. 2021 Jun;30 Suppl 1:8-17. | |||||
REF 13 | Inhibition of interleukin-1 release by IX 207-887. Agents Actions. 1990 Jun;30(3-4):350-62. | |||||
REF 14 | Modulation of secretory processes of phagocytes by IX 207-887. Springer Semin Immunopathol. 1993;14(4):345-52. | |||||
REF 15 | Cytos Biotechnology AG - Product Pipeline Review - 2013. Global Markets Direct. Dec 2013. | |||||
REF 16 | Identification of regions in interleukin-1 alpha important for activity. J Biol Chem. 1993 Oct 15;268(29):22105-11. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.