Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T12714
(Former ID: TTDI02606)
|
|||||
Target Name |
Zinc transporter 8 (SLC30A8)
|
|||||
Synonyms |
ZnT-8; Solute carrier family 30 member 8; SLC30A8
Click to Show/Hide
|
|||||
Gene Name |
SLC30A8
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Facilitates the accumulation of zinc from the cytoplasm into intracellular vesicles, being a zinc-efflux transporter. May be a major component for providing zinc to insulin maturation and/or storage processes in insulin-secreting pancreatic beta-cells.
Click to Show/Hide
|
|||||
BioChemical Class |
Cation diffusion facilitator
|
|||||
UniProt ID | ||||||
Sequence |
MEFLERTYLVNDKAAKMYAFTLESVELQQKPVNKDQCPRERPEELESGGMYHCHSGSKPT
EKGANEYAYAKWKLCSASAICFIFMIAEVVGGHIAGSLAVVTDAAHLLIDLTSFLLSLFS LWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTGVLVYLACERLLYPDYQIQATVMII VSSCAVAANIVLTVVLHQRCLGHNHKEVQANASVRAAFVHALGDLFQSISVLISALIIYF KPEYKIADPICTFIFSILVLASTITILKDFSILLMEGVPKSLNYSGVKELILAVDGVLSV HSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPD CLFCEDPCD Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Zinc transporter 8 (ZnT8) and cell function. Trends Endocrinol Metab. 2014 Aug;25(8):415-24. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.