Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T11253
(Former ID: TTDC00269)
|
|||||
| Target Name |
HSPB1 messenger RNA (HSPB1 mRNA)
|
|||||
| Synonyms |
Stress-responsive protein 27 (mRNA); SRP27 (mRNA); HspB1 (mRNA); Heat shock protein beta-1 (mRNA); Heat shock 27 kDa protein (mRNA); HSP28 (mRNA); HSP 27 (mRNA); Estrogen-regulated 24 kDa protein (mRNA); 28 kDa heat shock protein (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
HSPB1
|
|||||
| Target Type |
Discontinued target
|
[1] | ||||
| Disease | [+] 6 Target-related Diseases | + | ||||
| 1 | Rheumatoid arthritis [ICD-11: FA20] | |||||
| 2 | Bladder cancer [ICD-11: 2C94] | |||||
| 3 | Breast cancer [ICD-11: 2C60-2C6Y] | |||||
| 4 | Lung cancer [ICD-11: 2C25] | |||||
| 5 | Ovarian cancer [ICD-11: 2C73] | |||||
| 6 | Prostate cancer [ICD-11: 2C82] | |||||
| Function |
Plays a role in stress resistance and actin organization. Through its molecular chaperone activity may regulate numerous biological processes including the phosphorylation and the axonal transport of neurofilament proteins. Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT IPVTFESRAQLGGPEAAKSDETAAK Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | SB-242235 | Drug Info | Discontinued in Phase 1 | Arthritis | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | SB-242235 | Drug Info | [1] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Target Expression Profile (TEP) | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 4 KEGG Pathways | + | ||||
| 1 | MAPK signaling pathway | |||||
| 2 | VEGF signaling pathway | |||||
| 3 | Amoebiasis | |||||
| 4 | Epstein-Barr virus infection | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | EGFR1 Signaling Pathway | |||||
| Panther Pathway | [+] 4 Panther Pathways | + | ||||
| 1 | Angiogenesis | |||||
| 2 | VEGF signaling pathway | |||||
| 3 | p38 MAPK pathway | |||||
| 4 | CCKR signaling map ST | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | p38 signaling mediated by MAPKAP kinases | |||||
| 2 | Signaling mediated by p38-alpha and p38-beta | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | VEGFA-VEGFR2 Pathway | |||||
| 2 | MAPK6/MAPK4 signaling | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | p38 MAPK Signaling Pathway | |||||
| 2 | MAPK Signaling Pathway | |||||
| 3 | FAS pathway and Stress induction of HSP regulation | |||||
| 4 | Apoptosis-related network due to altered Notch3 in ovarian cancer | |||||
| 5 | Regulation of mRNA Stability by Proteins that Bind AU-rich Elements | |||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Biphenyl amide p38 kinase inhibitors 4: DFG-in and DFG-out binding modes. Bioorg Med Chem Lett. 2008 Aug 1;18(15):4433-7. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010787) | |||||
| REF 3 | Design and development of antisense drugs. Expert Opin. Drug Discov. 2008 3(10):1189-1207. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.