Target Information

Target General Information

Target ID

T08156 (Former ID: TTDI02096)

Target Name

Interferon-alpha 5 (IFNA5)

Synonyms

LeIF G; Interferon alphaG; Interferon alpha61; Interferon alpha5; Interferon alpha-G; Interferon alpha-61; Interferon alpha-5; IFNalpha5; IFN-alpha-5

Click to Show/Hide

Gene Name

IFNA5

Target Type

Clinical trial target

[1]

Disease

[+] 2 Target-related Diseases

Hepatitis virus infection [ICD-11: 1E50-1E51]

Postoperative inflammation [ICD-11: 1A00-CA43]

Function

Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. Produced by macrophages, IFN-alpha have antiviral activities.

Click to Show/Hide

BioChemical Class

Cytokine: interferon

UniProt ID

IFNA5_HUMAN

Sequence

MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE
ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN
LQERLRRKE

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 2 Clinical Trial Drugs

Interferon alpha 5

Drug Info

Phase 1/2

Infectious disease

[1], [2]

NAHE-001

Drug Info

Phase 1/2

Hepatitis C virus infection

[1]

Mode of Action

[+] 1 Modes of Action

Modulator

[+] 2 Modulator drugs

Interferon alpha 5

Drug Info

[1]

NAHE-001

Drug Info

[1]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Human Similarity Proteins Human Pathway Affiliation

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Human Similarity Proteins

Human Pathway Affiliation

There is no similarity protein (E value < 0.005) for this target

KEGG Pathway	Pathway ID	Affiliated Target
Cytokine-cytokine receptor interaction	hsa04060	Affiliated Target
Class: Environmental Information Processing => Signaling molecules and interaction	Pathway Hierarchy
PI3K-Akt signaling pathway	hsa04151	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Necroptosis	hsa04217	Affiliated Target
Class: Cellular Processes => Cell growth and death	Pathway Hierarchy
Toll-like receptor signaling pathway	hsa04620	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy
NOD-like receptor signaling pathway	hsa04621	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy
RIG-I-like receptor signaling pathway	hsa04622	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy
Cytosolic DNA-sensing pathway	hsa04623	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy
JAK-STAT signaling pathway	hsa04630	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy
Natural killer cell mediated cytotoxicity	hsa04650	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy
Click to Show/Hide the Information of Affiliated Human Pathways

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 15 KEGG Pathways

Cytokine-cytokine receptor interaction

Regulation of autophagy

PI3K-Akt signaling pathway

Toll-like receptor signaling pathway

RIG-I-like receptor signaling pathway

Cytosolic DNA-sensing pathway

Jak-STAT signaling pathway

Natural killer cell mediated cytotoxicity

Tuberculosis

Hepatitis C

Hepatitis B

Measles

Influenza A

Herpes simplex infection

Autoimmune thyroid disease

PID Pathway

[+] 2 PID Pathways

Downstream signaling in na&#xef

Reactome

[+] 4 Reactome Pathways

Interferon alpha/beta signaling

Regulation of IFNA signaling

TRAF6 mediated IRF7 activation

Factors involved in megakaryocyte development and platelet production

WikiPathways

[+] 3 WikiPathways

Toll-like receptor signaling pathway

Interferon alpha/beta signaling

Regulation of toll-like receptor signaling pathway

References

Top

REF 1

Interferons and viral infections. Biofactors. 2009 Jan-Feb;35(1):14-20.

REF 2

URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 4963).

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN