Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T06281
|
|||||
| Target Name |
Klebsiella Fimbrial subunit type 3 (Klebsiella mrkA)
|
|||||
| Gene Name |
Klebsiella mrkA
|
|||||
| Target Type |
Preclinical target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Pneumonia [ICD-11: CA40] | |||||
| UniProt ID | ||||||
| Sequence |
MKKVLLSAAMATAFFGMAAANAADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSP
VTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQG YLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYAT STPTTVTTGVVNSYATYEITYQ Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
| 1 | KP3 | Drug Info | Preclinical | Pneumonia due to Klebsiella pneumoniae | [1] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | KP3 | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Anti-MrkA Monoclonal Antibodies Reveal Distinct Structural and Antigenic Features of MrkA. PLoS One. 2017 Jan 20;12(1):e0170529. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.