Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T01777
(Former ID: TTDR01180)
|
|||||
Target Name |
Adrenergic receptor alpha-2C (ADRA2C)
|
|||||
Synonyms |
Subtype C4; Alpha-2CAR; Alpha-2C adrenoreceptor; Alpha-2C adrenoceptor; Alpha-2C adrenergic receptor; Alpha-2 adrenergic receptor subtype C4; ADRA2RL2; ADRA2L2
Click to Show/Hide
|
|||||
Gene Name |
ADRA2C
|
|||||
Target Type |
Successful target
|
[1] | ||||
Disease | [+] 6 Target-related Diseases | + | ||||
1 | Glaucoma [ICD-11: 9C61] | |||||
2 | Hypertension [ICD-11: BA00-BA04] | |||||
3 | Hypotension [ICD-11: BA20-BA21] | |||||
4 | Obesity [ICD-11: 5B80-5B81] | |||||
5 | Ocular disease [ICD-11: N.A.] | |||||
6 | Substance abuse [ICD-11: 6C40] | |||||
Function |
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Click to Show/Hide
|
|||||
BioChemical Class |
GPCR rhodopsin
|
|||||
UniProt ID | ||||||
Sequence |
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Approved Drug(s) | [+] 9 Approved Drugs | + | ||||
1 | Amezinium | Drug Info | Approved | Hypotension | [2] | |
2 | Amosulalol | Drug Info | Approved | Hypertension | [1] | |
3 | Brimonidine | Drug Info | Approved | Ocular hypertension | [3], [4] | |
4 | Dihydroergocristine | Drug Info | Approved | Alcohol dependence | [5], [6] | |
5 | MOXONIDINE | Drug Info | Approved | Alcohol dependence | [7] | |
6 | Propylhexedrine | Drug Info | Approved | Obesity | [2] | |
7 | Rilmenidine | Drug Info | Approved | Hypertension | [2] | |
8 | Tetrahydrozoline | Drug Info | Approved | Ocular disease | [8] | |
9 | Xylometazoline | Drug Info | Phase 4 | Allergic rhinitis | [9], [10] | |
Clinical Trial Drug(s) | [+] 8 Clinical Trial Drugs | + | ||||
1 | IDAZOXAN HYDROCHLORIDE | Drug Info | Phase 3 | Neurological disorder | [11] | |
2 | TNX-102 | Drug Info | Phase 3 | Fibromyalgia | [12] | |
3 | AGN-XX/YY | Drug Info | Phase 2 | Fibromyalgia | [13] | |
4 | BAY1193397 | Drug Info | Phase 2 | Peripheral arterial disease | [14] | |
5 | Fadolmidine | Drug Info | Phase 2 | Neuropathic pain | [15] | |
6 | MEDETOMIDINE | Drug Info | Phase 2 | Pain | [16] | |
7 | ORM-12741 | Drug Info | Phase 2 | Alzheimer disease | [17] | |
8 | V-101 | Drug Info | Phase 2 | Erythema | [18] | |
Discontinued Drug(s) | [+] 15 Discontinued Drugs | + | ||||
1 | INDORAMIN | Drug Info | Withdrawn from market | Hypertension | [2], [19] | |
2 | Ecabapide | Drug Info | Discontinued in Preregistration | Peptic ulcer | [20] | |
3 | Delequamine hydrochloride | Drug Info | Discontinued in Phase 3 | Male sexual disorder | [21] | |
4 | FLUPAROXAN | Drug Info | Discontinued in Phase 3 | Depression | [22], [23] | |
5 | NOLOMIROLE HYDROCHLORIDE | Drug Info | Discontinued in Phase 3 | Heart failure | [24] | |
6 | Deriglidole | Drug Info | Discontinued in Phase 2 | Diabetic complication | [25] | |
7 | GYKI-16084 | Drug Info | Discontinued in Phase 2 | Prostate disease | [26] | |
8 | JTH-601 | Drug Info | Discontinued in Phase 2 | Prostate disease | [27] | |
9 | NMI-870 | Drug Info | Discontinued in Phase 2 | Sexual dysfunction | [28] | |
10 | SGB-1534 | Drug Info | Discontinued in Phase 2 | Hypotension | [29] | |
11 | GYKI-12743 | Drug Info | Discontinued in Phase 1 | Hypertension | [30] | |
12 | A-75169 | Drug Info | Terminated | Glaucoma/ocular hypertension | [32] | |
13 | F-14413 | Drug Info | Terminated | Alzheimer disease | [33] | |
14 | Midaglizole | Drug Info | Terminated | Asthma | [34] | |
15 | SNAP-5089 | Drug Info | Terminated | Heart arrhythmia | [35], [36] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | 5-(N,N-hexamethylene)-amiloride | Drug Info | Preclinical | Coronavirus infection | [31] | |
Mode of Action | [+] 5 Modes of Action | + | ||||
Modulator | [+] 21 Modulator drugs | + | ||||
1 | Amezinium | Drug Info | [2], [37] | |||
2 | Amosulalol | Drug Info | [1], [2] | |||
3 | Brimonidine | Drug Info | [3] | |||
4 | Dihydroergocristine | Drug Info | [2], [6] | |||
5 | Propylhexedrine | Drug Info | [2], [39] | |||
6 | Rilmenidine | Drug Info | [2], [40] | |||
7 | Tetrahydrozoline | Drug Info | [2], [8] | |||
8 | Xylometazoline | Drug Info | [2], [41] | |||
9 | IDAZOXAN HYDROCHLORIDE | Drug Info | [42] | |||
10 | Ecabapide | Drug Info | [50] | |||
11 | Delequamine hydrochloride | Drug Info | [51] | |||
12 | FLUPAROXAN | Drug Info | [52] | |||
13 | NOLOMIROLE HYDROCHLORIDE | Drug Info | [53] | |||
14 | Deriglidole | Drug Info | [54] | |||
15 | NMI-870 | Drug Info | [59] | |||
16 | SGB-1534 | Drug Info | [60] | |||
17 | GYKI-12743 | Drug Info | [61] | |||
18 | A-75169 | Drug Info | [63] | |||
19 | Midaglizole | Drug Info | [67] | |||
20 | ETHOXY-IDAZOXAN | Drug Info | [91] | |||
21 | V-103 | Drug Info | [98] | |||
Inhibitor | [+] 60 Inhibitor drugs | + | ||||
1 | MOXONIDINE | Drug Info | [38] | |||
2 | MEDETOMIDINE | Drug Info | [46] | |||
3 | INDORAMIN | Drug Info | [49] | |||
4 | MAZAPERTINE | Drug Info | [57] | |||
5 | A-80426 | Drug Info | [64] | |||
6 | SK&F-104078 | Drug Info | [49] | |||
7 | SNAP-5089 | Drug Info | [68] | |||
8 | WB-4101 | Drug Info | [69] | |||
9 | (+/-)-nantenine | Drug Info | [70] | |||
10 | (1,2,3,4-Tetrahydro-isoquinolin-3-yl)-methanol | Drug Info | [71] | |||
11 | (1H-Benzoimidazol-5-yl)-(1H-imidazol-2-yl)-amine | Drug Info | [72] | |||
12 | (1H-Imidazol-2-yl)-quinoxalin-6-yl-amine | Drug Info | [72] | |||
13 | (2,6-Dichloro-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [72] | |||
14 | (2-Bromo-phenyl)-(1H-imidazol-2-yl)-amine | Drug Info | [72] | |||
15 | (2-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine | Drug Info | [73] | |||
16 | (3-Ethyl-indol-1-yl)-propyl-pyridin-4-yl-amine | Drug Info | [73] | |||
17 | (3-Methyl-indol-1-yl)-propyl-pyridin-4-yl-amine | Drug Info | [73] | |||
18 | (R)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [74] | |||
19 | (S)-3-Methyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [74] | |||
20 | 1,2,3,4,4a,5,10,10a-Octahydro-benzo[g]quinoline | Drug Info | [75] | |||
21 | 1,2,3,4,5,6-Hexahydro-benzo[c]azocine | Drug Info | [74] | |||
22 | 1,2,3,4-Tetrahydro-benzo[h]isoquinolin-8-ol | Drug Info | [76] | |||
23 | 1,2,3,4-Tetrahydro-isoquinolin-7-ol | Drug Info | [76] | |||
24 | 1,2,3,4-Tetrahydro-pyrazino[1,2-a]indole | Drug Info | [77] | |||
25 | 1,2,3,4-tetrahydroisoquinoline | Drug Info | [78] | |||
26 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol | Drug Info | [79] | |||
27 | 2,3,4,5-Tetrahydro-1H-benzo[c]azepine | Drug Info | [74] | |||
28 | 2,3,4,5-Tetrahydro-1H-benzo[e][1,4]diazepine | Drug Info | [74] | |||
29 | 2,3,4,5-Tetrahydro-benzo[f][1,4]oxazepine | Drug Info | [74] | |||
30 | 2,3-Dihydro-1H-isoindole | Drug Info | [74] | |||
31 | 2-BFi | Drug Info | [80] | |||
32 | 3-Fluoromethyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [81] | |||
33 | 3-Methoxymethyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [71] | |||
34 | 3-Methyl-1,2,3,4-tetrahydro-isoquinoline | Drug Info | [74] | |||
35 | 4-(1-Naphthalen-1-yl-ethyl)-1H-imidazole | Drug Info | [46] | |||
36 | 4-(4-Methyl-indan-1-yl)-1H-imidazole | Drug Info | [82] | |||
37 | 5-Aminomethyl-naphthalen-2-ol | Drug Info | [76] | |||
38 | 6,7,8,9-Tetrahydro-5-thia-8-aza-benzocycloheptene | Drug Info | [74] | |||
39 | 7-Methoxy-2,3,4,9-tetrahydro-1H-beta-carboline | Drug Info | [85] | |||
40 | 8-Methoxy-1,2,3,4-tetrahydro-benzo[h]isoquinoline | Drug Info | [76] | |||
41 | Butyl-indol-1-yl-pyridin-4-yl-amine | Drug Info | [73] | |||
42 | C-(6-Methoxy-naphthalen-1-yl)-methylamine | Drug Info | [76] | |||
43 | C-Naphthalen-1-yl-methylamine | Drug Info | [76] | |||
44 | CONESSINE | Drug Info | [90] | |||
45 | Ethyl-indol-1-yl-pyridin-4-yl-amine | Drug Info | [73] | |||
46 | GNF-PF-2857 | Drug Info | [92] | |||
47 | GNF-PF-3878 | Drug Info | [92] | |||
48 | Indol-1-yl-methyl-pyridin-4-yl-amine | Drug Info | [73] | |||
49 | Indol-1-yl-prop-2-ynyl-pyridin-4-yl-amine | Drug Info | [73] | |||
50 | Indol-1-yl-pyridin-4-yl-amine | Drug Info | [73] | |||
51 | METHYLNORADRENALINE | Drug Info | [69] | |||
52 | MEZILAMINE | Drug Info | [94] | |||
53 | PIPEROXAN | Drug Info | [69] | |||
54 | R-226161 | Drug Info | [96] | |||
55 | S-34324 | Drug Info | [64] | |||
56 | SK&F-64139 | Drug Info | [78] | |||
57 | SNAP-5150 | Drug Info | [68] | |||
58 | TRACIZOLINE | Drug Info | [85] | |||
59 | Tramazoline | Drug Info | [69] | |||
60 | TRYPTOLINE | Drug Info | [85] | |||
Antagonist | [+] 18 Antagonist drugs | + | ||||
1 | TNX-102 | Drug Info | [43] | |||
2 | BAY1193397 | Drug Info | [14] | |||
3 | ORM-12741 | Drug Info | [47] | |||
4 | GYKI-16084 | Drug Info | [55] | |||
5 | JTH-601 | Drug Info | [56] | |||
6 | MK-912 | Drug Info | [58] | |||
7 | ARC239 | Drug Info | [65] | |||
8 | F-14413 | Drug Info | [66] | |||
9 | 5-methylurapidil | Drug Info | [83] | |||
10 | all-trans-4-oxo-retinoic acid | Drug Info | [87] | |||
11 | Ciproxifan | Drug Info | [89] | |||
12 | JP1302 | Drug Info | [92], [93] | |||
13 | piribedil | Drug Info | [95] | |||
14 | spiroxatrine | Drug Info | [97] | |||
15 | [125I]BE-2254 | Drug Info | [100] | |||
16 | [3H]MK-912 | Drug Info | [102] | |||
17 | [3H]rauwolscine | Drug Info | [103] | |||
18 | [3H]RX821002 | Drug Info | [104], [105] | |||
Agonist | [+] 12 Agonist drugs | + | ||||
1 | AGN-XX/YY | Drug Info | [44] | |||
2 | Fadolmidine | Drug Info | [45] | |||
3 | V-101 | Drug Info | [48] | |||
4 | 6-fluoro-noradrenaline | Drug Info | [84] | |||
5 | A61603 | Drug Info | [86] | |||
6 | amidephrine | Drug Info | [84] | |||
7 | Chloroethylclonidine | Drug Info | [88] | |||
8 | cirazoline | Drug Info | [84] | |||
9 | indanidine | Drug Info | [84] | |||
10 | SKF 89748 | Drug Info | [84] | |||
11 | xylazine | Drug Info | [99] | |||
12 | [125I]HEAT | Drug Info | [101] | |||
Modulator (allosteric modulator) | [+] 1 Modulator (allosteric modulator) drugs | + | ||||
1 | 5-(N,N-hexamethylene)-amiloride | Drug Info | [62] |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Pathway Affiliation
of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.
Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes
(Pharmacol Rev, 58: 259-279, 2006).
Human Similarity Proteins
Human Pathway Affiliation
|
KEGG Pathway | Pathway ID | Affiliated Target | Pathway Map |
---|---|---|---|
cGMP-PKG signaling pathway | hsa04022 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signal transduction | Pathway Hierarchy | ||
Neuroactive ligand-receptor interaction | hsa04080 | Affiliated Target |
![]() |
Class: Environmental Information Processing => Signaling molecules and interaction | Pathway Hierarchy |
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Drug Property Profile of Target | Top | |
---|---|---|
(1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
||
(3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
||
(5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
||
"RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five |
Co-Targets | Top | |||||
---|---|---|---|---|---|---|
Co-Targets |
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
Target Affiliated Biological Pathways | Top | |||||
---|---|---|---|---|---|---|
KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
1 | cGMP-PKG signaling pathway | |||||
2 | Neuroactive ligand-receptor interaction | |||||
Panther Pathway | [+] 2 Panther Pathways | + | ||||
1 | Alpha adrenergic receptor signaling pathway | |||||
2 | Heterotrimeric G-protein signaling pathway-Gi alpha and Gs alpha mediated pathway | |||||
Reactome | [+] 6 Reactome Pathways | + | ||||
1 | Adrenoceptors | |||||
2 | Adrenaline signalling through Alpha-2 adrenergic receptor | |||||
3 | Adrenaline,noradrenaline inhibits insulin secretion | |||||
4 | G alpha (i) signalling events | |||||
5 | G alpha (z) signalling events | |||||
6 | Surfactant metabolism | |||||
WikiPathways | [+] 6 WikiPathways | + | ||||
1 | Monoamine GPCRs | |||||
2 | GPCRs, Class A Rhodopsin-like | |||||
3 | Platelet Aggregation (Plug Formation) | |||||
4 | Integration of energy metabolism | |||||
5 | GPCR ligand binding | |||||
6 | GPCR downstream signaling |
Target-Related Models and Studies | Top | |||||
---|---|---|---|---|---|---|
Target Validation |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Effects of amosulalol, a combined alpha 1- and beta-adrenoceptor-blocking agent, on ischemic myocardial energy metabolism in dogs. J Pharm Sci. 1993 Mar;82(3):291-5. | |||||
REF 2 | Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015 | |||||
REF 3 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 520). | |||||
REF 4 | ClinicalTrials.gov (NCT00675207) Comparison of Brimonidine Purite, Dorzolamide, and Brinzolamide as Adjunctive Therapy to Prostaglandin Analogs. U.S. National Institutes of Health. | |||||
REF 5 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 278). | |||||
REF 6 | Effect of dihydroergocristine on blood pressure and activity at peripheral alpha-adrenoceptors in pithed rats. Eur J Pharmacol. 1984 Jan 13;97(1-2):21-7. | |||||
REF 7 | The role of I(1)-imidazoline and alpha(2)-adrenergic receptors in the modulation of glucose metabolism in the spontaneously hypertensive obese rat ... J Pharmacol Exp Ther. 2003 Aug;306(2):646-57. | |||||
REF 8 | Prolonged cardiovascular effects after unintentional ingestion of tetrahydrozoline. Clin Toxicol (Phila). 2008 Feb;46(2):171-2. | |||||
REF 9 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 517). | |||||
REF 10 | ClinicalTrials.gov (NCT00630474) Nasal Decongestion and Obstructive Sleep Apnea. U.S. National Institutes of Health. | |||||
REF 11 | ClinicalTrials.gov (NCT00294944) The Effectiveness of Idazoxan in Treating TRD. U.S. National Institutes of Health. | |||||
REF 12 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800017946) | |||||
REF 13 | Clinical pipeline report, company report or official report of ACADIA Pharmaceuticals. | |||||
REF 14 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 15 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
REF 16 | Sedative and cardiopulmonary effects of medetomidine hydrochloride and xylazine hydrochloride and their reversal with atipamezole hydrochloride in calves. Am J Vet Res. 2008 Mar;69(3):319-29. | |||||
REF 17 | ClinicalTrials.gov (NCT02471196) Efficacy of ORM-12741 on Agitation/Aggression Symptoms in Alzheimer's Disease. | |||||
REF 18 | ClinicalTrials.gov (NCT01186068) Dose Response Study of Patients With Erythematous Rosacea. U.S. National Institutes of Health. | |||||
REF 19 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 501). | |||||
REF 20 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000582) | |||||
REF 21 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800008832) | |||||
REF 22 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 41). | |||||
REF 23 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000678) | |||||
REF 24 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003364) | |||||
REF 25 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000010) | |||||
REF 26 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010746) | |||||
REF 27 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800010685) | |||||
REF 28 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800014166) | |||||
REF 29 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000148) | |||||
REF 30 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002059) | |||||
REF 31 | Coronaviruses - drug discovery and therapeutic options. Nat Rev Drug Discov. 2016 May;15(5):327-47. | |||||
REF 32 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800003469) | |||||
REF 33 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800019997) | |||||
REF 34 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800000085) | |||||
REF 35 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 498). | |||||
REF 36 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800006771) | |||||
REF 37 | Pharmacology of amezinium, a novel antihypotensive drug. III. Studies on the mechanism of action. Arzneimittelforschung. 1981;31(9a):1558-65. | |||||
REF 38 | Synthesis and pharmacologic evaluation of 2-endo-amino-3-exo-isopropylbicyclo[2.2.1]heptane: a potent imidazoline1 receptor specific agent. J Med Chem. 1996 Mar 15;39(6):1193-5. | |||||
REF 39 | Airway compromise and delayed death following attempted central vein injection of propylhexedrine. J Emerg Med. 1994 Nov-Dec;12(6):795-7. | |||||
REF 40 | Rilmenidine-induced ocular hypotension: role of imidazoline1 and alpha 2 receptors. Curr Eye Res. 1996 Sep;15(9):943-50. | |||||
REF 41 | Alpha-adrenoceptor agonistic activity of oxymetazoline and xylometazoline. Fundam Clin Pharmacol. 2010 Dec;24(6):729-39. | |||||
REF 42 | Different sites of action for alpha 2-adrenoceptor antagonists in the modulation of noradrenaline release and contraction response in the vas deferens of the rat. J Pharm Pharmacol. 1992 Mar;44(3):231-4. | |||||
REF 43 | Clinical pipeline report, company report or official report of Tonix Pharmaceuticals. | |||||
REF 44 | Patent WO2008058220 A2. | |||||
REF 45 | Antinociceptive properties of fadolmidine (MPV-2426), a novel alpha2-adrenoceptor agonist. CNS Drug Rev. 2004 Summer;10(2):117-26. | |||||
REF 46 | A structure-activity relationship study of benzylic modifications of 4-[1-(1-naphthyl)ethyl]-1H-imidazoles on alpha 1- and alpha 2-adrenergic recep... J Med Chem. 1994 Jul 22;37(15):2328-33. | |||||
REF 47 | A double-blind, randomized, placebo-controlled crossover trial of the alpha2C-adrenoceptor antagonist ORM-12741 for prevention of cold-induced vasospasm in patients with systemic sclerosis. Rheumatology (Oxford). 2014 May;53(5):948-52. | |||||
REF 48 | Rosacea: update on management and emerging therapies. Skin Therapy Lett. 2012 Dec;17(10):1-4. | |||||
REF 49 | Alpha- and beta-adrenoceptors: from the gene to the clinic. 1. Molecular biology and adrenoceptor subclassification. J Med Chem. 1995 Sep 1;38(18):3415-44. | |||||
REF 50 | Identification of major biliary and urinary metabolites of ecabapide in rats. Xenobiotica. 1996 Sep;26(9):983-94. | |||||
REF 51 | Modulation of sexual behaviour in the rat by a potent and selective alpha 2-adrenoceptor antagonist, delequamine (RS-15385-197). Br J Pharmacol. 1996 May;118(1):63-72. | |||||
REF 52 | The pharmacology of fluparoxan: a selective alpha 2-adrenoceptor antagonist. Br J Pharmacol. 1991 Apr;102(4):887-95. | |||||
REF 53 | Effect of nolomirole on monocrotaline-induced heart failure. Pharmacol Res. 2004 Jan;49(1):1-5. | |||||
REF 54 | Mechanisms of the hypoglycemic effects of the alpha2-adrenoceptor antagonists SL84.0418 and deriglidole. Life Sci. 1998;62(9):839-52. | |||||
REF 55 | A novel approach to the treatment of benign prostatic hyperplasia. BJU Int. 2006 Jun;97(6):1252-5. | |||||
REF 56 | Effect of JTH-601, a novel alpha(1)-adrenoceptor antagonist, on prostate function in dogs. Eur J Pharmacol. 2000 Apr 7;394(1):123-30. | |||||
REF 57 | A new arylpiperazine antipsychotic with high D2/D3/5-HT1A/alpha 1A-adrenergic affinity and a low potential for extrapyramidal effects. J Med Chem. 1994 Apr 15;37(8):1060-2. | |||||
REF 58 | Silent alpha(2C)-adrenergic receptors enable cold-induced vasoconstriction in cutaneous arteries. Am J Physiol Heart Circ Physiol. 2000 Apr;278(4):H1075-83. | |||||
REF 59 | Female Sexual Dysfunction: Therapeutic Options and Experimental Challenges. Cardiovasc Hematol Agents Med Chem. 2009 October; 7(4): 260-269. | |||||
REF 60 | Potent alpha-adrenoceptor blocking action of SGB-1534, a new quinazoline antihypertensive agent in vitro experiments. Gen Pharmacol. 1986;17(2):143-9. | |||||
REF 61 | GYKI-12743 a new postsynaptic vascular alpha-adrenoceptor antagonist. Acta Physiol Hung. 1991;77(3-4):257-67. | |||||
REF 62 | Characterization of the allosteric interactions between antagonists and amiloride analogues at the human alpha2A-adrenergic receptor. Mol Pharmacol. 1998 May;53(5):916-25. | |||||
REF 63 | A-75169 HCI: Pharmacological profile and ocular pharmacology studies of a new alpha-2 antagonist. Drug Development Research Volume 28, Issue 1, pages 56-64, January 1993. | |||||
REF 64 | Discovery of a new series of centrally active tricyclic isoxazoles combining serotonin (5-HT) reuptake inhibition with alpha2-adrenoceptor blocking... J Med Chem. 2005 Mar 24;48(6):2054-71. | |||||
REF 65 | Potent alpha(2A)-adrenoceptor-mediated vasoconstriction by brimonidine in porcine ciliary arteries. Invest Ophthalmol Vis Sci. 2001 Aug;42(9):2049-55. | |||||
REF 66 | Activation of noradrenergic transmission by alpha2-adrenoceptor antagonists counteracts deafferentation-induced neuronal death and cell proliferation in the adult mouse olfactory bulb. Exp Neurol. 2005 Aug;194(2):444-56. | |||||
REF 67 | Studies of midaglizole (DG-5128). A new type of oral hypoglycemic drug in healthy subjects. Diabetes. 1987 Feb;36(2):216-20. | |||||
REF 68 | Design and synthesis of novel dihydropyridine alpha-1a antagonists. Bioorg Med Chem Lett. 1999 Oct 4;9(19):2843-8. | |||||
REF 69 | alpha 2 adrenoceptors: classification, localization, mechanisms, and targets for drugs. J Med Chem. 1982 Dec;25(12):1389-401. | |||||
REF 70 | Synthetic studies and pharmacological evaluations on the MDMA ('Ecstasy') antagonist nantenine. Bioorg Med Chem Lett. 2010 Jan 15;20(2):628-31. | |||||
REF 71 | 3,7-Disubstituted-1,2,3,4-tetrahydroisoquinolines display remarkable potency and selectivity as inhibitors of phenylethanolamine N-methyltransferas... J Med Chem. 1999 Jun 3;42(11):1982-90. | |||||
REF 72 | Synthesis and evaluation of 2-(arylamino)imidazoles as alpha 2-adrenergic agonists. J Med Chem. 1997 Jan 3;40(1):18-23. | |||||
REF 73 | Synthesis and structure-activity relationships of N-propyl-N-(4-pyridinyl)-1H-indol-1-amine (besipirdine) and related analogs as potential therapeu... J Med Chem. 1996 Jan 19;39(2):570-81. | |||||
REF 74 | Effect of ring size or an additional heteroatom on the potency and selectivity of bicyclic benzylamine-type inhibitors of phenylethanolamine N-meth... J Med Chem. 1996 Aug 30;39(18):3539-46. | |||||
REF 75 | N-(Iodopropenyl)-octahydrobenzo[f]- and -[g]quinolines: synthesis and adrenergic and dopaminergic activity studies. J Med Chem. 1998 Oct 8;41(21):4165-70. | |||||
REF 76 | Examination of the role of the acidic hydrogen in imparting selectivity of 7-(aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline (SK&F 29661) toward inh... J Med Chem. 1997 Dec 5;40(25):3997-4005. | |||||
REF 77 | Pyrazino[1,2-a]indoles as novel high-affinity and selective imidazoline I(2) receptor ligands. Bioorg Med Chem Lett. 2004 Feb 23;14(4):1003-5. | |||||
REF 78 | Comparison of the binding of 3-fluoromethyl-7-sulfonyl-1,2,3,4-tetrahydroisoquinolines with their isosteric sulfonamides to the active site of phen... J Med Chem. 2006 Sep 7;49(18):5424-33. | |||||
REF 79 | 1-((S)-2-aminopropyl)-1H-indazol-6-ol: a potent peripherally acting 5-HT2 receptor agonist with ocular hypotensive activity. J Med Chem. 2006 Jan 12;49(1):318-28. | |||||
REF 80 | Probes for imidazoline binding sites: synthesis and evaluation of a selective, irreversible I2 ligand. Bioorg Med Chem Lett. 2000 Mar 20;10(6):605-7. | |||||
REF 81 | 3-hydroxymethyl-7-(N-substituted aminosulfonyl)-1,2,3,4-tetrahydroisoquinoline inhibitors of phenylethanolamine N-methyltransferase that display re... J Med Chem. 2005 Jan 13;48(1):134-40. | |||||
REF 82 | Medetomidine analogs as alpha 2-adrenergic ligands. 3. Synthesis and biological evaluation of a new series of medetomidine analogs and their potent... J Med Chem. 1997 Sep 12;40(19):3014-24. | |||||
REF 83 | Phe-308 and Phe-312 in transmembrane domain 7 are major sites of alpha 1-adrenergic receptor antagonist binding. Imidazoline agonists bind like ant... J Biol Chem. 2001 Jul 6;276(27):25366-71. | |||||
REF 84 | Selectivity of agonists for cloned alpha 1-adrenergic receptor subtypes. Mol Pharmacol. 1994 Nov;46(5):929-36. | |||||
REF 85 | Binding of an imidazopyridoindole at imidazoline I2 receptors. Bioorg Med Chem Lett. 2004 Jan 19;14(2):527-9. | |||||
REF 86 | A-61603, a potent alpha 1-adrenergic receptor agonist, selective for the alpha 1A receptor subtype. J Pharmacol Exp Ther. 1995 Jul;274(1):97-103. | |||||
REF 87 | Discovery of new tetracyclic tetrahydrofuran derivatives as potential broad-spectrum psychotropic agents. J Med Chem. 2005 Mar 24;48(6):1709-12. | |||||
REF 88 | Selective irreversible binding of chloroethylclonidine at alpha 1- and alpha 2-adrenoceptor subtypes. Mol Pharmacol. 1993 Dec;44(6):1165-70. | |||||
REF 89 | The histamine H3 receptor: from gene cloning to H3 receptor drugs. Nat Rev Drug Discov. 2005 Feb;4(2):107-20. | |||||
REF 90 | The alkaloid conessine and analogues as potent histamine H3 receptor antagonists. J Med Chem. 2008 Sep 11;51(17):5423-30. | |||||
REF 91 | Discriminative stimulus properties of ethoxy idazoxan. J Psychopharmacol. 1995 Jan;9(3):228-33. | |||||
REF 92 | Structure-activity relationship of quinoline derivatives as potent and selective alpha(2C)-adrenoceptor antagonists. J Med Chem. 2006 Oct 19;49(21):6351-63. | |||||
REF 93 | Pharmacological characterization and CNS effects of a novel highly selective alpha2C-adrenoceptor antagonist JP-1302. Br J Pharmacol. 2007 Feb;150(4):391-402. | |||||
REF 94 | 4-Amino-6-chloro-2-piperazinopyrimidines with selective affinity for alpha 2-adrenoceptors. J Med Chem. 1986 Aug;29(8):1394-8. | |||||
REF 95 | Differential actions of antiparkinson agents at multiple classes of monoaminergic receptor. I. A multivariate analysis of the binding profiles of 14 drugs at 21 native and cloned human receptor subtypes. J Pharmacol Exp Ther. 2002 Nov;303(2):791-804. | |||||
REF 96 | Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60. | |||||
REF 97 | Affinity of serotonin receptor antagonists and agonists to recombinant and native alpha1-adrenoceptor subtypes. Jpn J Pharmacol. 2001 Jun;86(2):189-95. | |||||
REF 98 | URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 27). | |||||
REF 99 | Ligand efficacy and potency at recombinant alpha2 adrenergic receptors: agonist-mediated [35S]GTPgammaS binding. Biochem Pharmacol. 1998 Apr 1;55(7):1035-43. | |||||
REF 100 | Cloning and pharmacological characterization of human alpha-1 adrenergic receptors: sequence corrections and direct comparison with other species homologues. J Pharmacol Exp Ther. 1995 Jan;272(1):134-42. | |||||
REF 101 | KMD-3213, a novel, potent, alpha 1a-adrenoceptor-selective antagonist: characterization using recombinant human alpha 1-adrenoceptors and native tissues. Mol Pharmacol. 1995 Aug;48(2):250-8. | |||||
REF 102 | The novel alpha-2 adrenergic radioligand [3H]-MK912 is alpha-2C selective among human alpha-2A, alpha-2B and alpha-2C adrenoceptors. J Pharmacol Exp Ther. 1994 Dec;271(3):1558-65. | |||||
REF 103 | Pharmacological characteristics of alpha 2-adrenergic receptors: comparison of pharmacologically defined subtypes with subtypes identified by molecular cloning. Mol Pharmacol. 1992 Jul;42(1):1-5. | |||||
REF 104 | Further characterization of human alpha 2-adrenoceptor subtypes: [3H]RX821002 binding and definition of additional selective drugs. Eur J Pharmacol. 1994 Jan 24;252(1):43-9. | |||||
REF 105 | Alpha-adrenoreceptor reagents. 4. Resolution of some potent selective prejunctional alpha 2-adrenoreceptor antagonists. J Med Chem. 1986 Oct;29(10):2000-3. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.