Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T98459 | Target Info | |||
| Target Name | G2/mitotic-specific cyclin B1 (CCNB1) | ||||
| Synonyms | G2/mitotic-specific cyclin-B1; Cyclin B1; CCNB | ||||
| Target Type | Patented-recorded Target | ||||
| Gene Name | CCNB1 | ||||
| Biochemical Class | Eukaryotic nuclear pore complex | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Upstream stimulatory factor 1 (USF1) homodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Helix-loop-helix / leucine zipper factors (bHLH-ZIP) | ||||
| Family | Upstream stimulatory factor | ||||
| Regulation Mechanism | The study revealed that an upstream stimulatory factor (USF)-binding site and its cognate transcription factor(s) are critical for expression from the CCNB1 promoter in cycling HeLa cells. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVM
YRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGTAAETHYTYFP STAVGDGAGGTTSGSTAAVVTTQGSEALLGQATPPGTGQFFVMMSPQEVLQGGSQRSIAP RTHPYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSK GGILSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHG LEVVIKNDSN |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein C-III (ApoCIII) | Clinical trial Target | Target Info | [2] | |
| Cyclins | [+] 1 Cyclins Co-regulated By This TF | + | |||
| 1 | G2/mitotic-specific cyclin B1 (CCNB1) | Patented-recorded Target | Target Info | [1] | |
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Heme oxygenase 1 (HMOX1) | Clinical trial Target | Target Info | [3] | |
| Serpin proteins | [+] 1 Serpin proteins Co-regulated By This TF | + | |||
| 1 | Angiotensinogen (AGT) | Literature-reported Target | Target Info | [4] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Upstream stimulatory factor regulates expression of the cell cycle-dependent cyclin B1 gene promoter. Mol Cell Biol. 1995 May;15(5):2782-90. | ||||
| REF 2 | Two initiator-like elements are required for the combined activation of the human apolipoprotein C-III promoter by upstream stimulatory factor and ... J Biol Chem. 2002 Apr 26;277(17):15199-206. | ||||
| REF 3 | Interaction of upstream stimulatory factor with the human heme oxygenase gene promoter. Eur J Biochem. 1990 Mar 10;188(2):231-7. | ||||
| REF 4 | Molecular variation of the human angiotensinogen core promoter element located between the TATA box and transcription initiation site affects its transcriptional activity. J Biol Chem. 1997 Nov 28;272(48):30558-62. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.