Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T90572 | Target Info | |||
| Target Name | Insulin-like growth factor-II (IGF2) | ||||
| Synonyms | T3M-11-derived growth factor; Somatomedin-A; Somatomedin A; PP1446; Insulin-like growth factor II; Insulin-like growth factor 2; IGF-II | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | IGF2 | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | CCAAT/enhancer-binding protein (CEBP) homo/heterodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Leucine zipper factors (bZIP) | ||||
| Family | C/EBP-like factors | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | The human gene coding for IGF2 contains four promoters (P1-P4), that are subjected to tissue-specific and development-dependent regulation. Promoter P1 can be activated by C/EBP, whereas this transcription factor has no effect on the expression of promoter P3. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [1] | |||
| UniProt ID | |||||
| Sequence |
MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHET
SIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVM PGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFP YQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPA LGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSR DKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Apolipoproteins | [+] 1 Apolipoproteins Co-regulated By This TF | + | |||
| 1 | Apolipoprotein A-I (APOA1) | Clinical trial Target | Target Info | [2] | |
| Ester hydrolases | [+] 1 Ester hydrolases Co-regulated By This TF | + | |||
| 1 | Lipoprotein lipase (LPL) | Successful Target | Target Info | [3] | |
| Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
| 1 | Insulin-like growth factor-II (IGF2) | Clinical trial Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | The liver-specific promoter of the human insulin-like growth factor II gene is activated by CCAAT/enhancer binding protein (C/EBP). Nucleic Acids Res. 1992 Jun 25;20(12):3099-104. | ||||
| REF 2 | Promoter elements and factors involved in hepatic transcription of the human ApoA-I gene positive and negative regulators bind to overlapping sites. J Biol Chem. 1991 Mar 25;266(9):5790-7. | ||||
| REF 3 | Transcriptional regulation of the human lipoprotein lipase gene in 3T3-L1 adipocytes. J Biol Chem. 1991 Oct 5;266(28):18958-63. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.