Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T89065 | Target Info | |||
| Target Name | Lysyl hydroxylase 1 (PLOD1) | ||||
| Synonyms | Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1; Peptidyllysine, 2-oxoglutarate:oxygen 5-oxidoreductase; PLOD; Lysyl hydroxylase; LLH; LH1; LH | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | PLOD1 | ||||
| Biochemical Class | Paired donor oxygen oxidoreductase | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Pituitary homeobox 2 (PITX2) | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Homeo domain | ||||
| Regulation Mechanism | PITX2C and Nkx2.5 synergistically regulate PLOD1 expression through binding to the DNA elements, while PLOD1 promoter is regulated by Nkx2.5. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay, Luciferase Reporter Assay, -Galactosidase Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
METNCRKLVSACVQLGVQPAAVECLFSKDSEIKKVEFTDSPESRKEAASSKFFPRQHPGA
NEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAV WTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWA AKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLN SLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQ NPASNLSACQYAVDRPV |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
| 1 | Lysyl hydroxylase 1 (PLOD1) | Clinical trial Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | PITX2 isoform-specific regulation of atrial natriuretic factor expression: synergism and repression with Nkx2.5. J Biol Chem. 2003 Jun 20;278(25):22437-45. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.