Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T36729 Target Info
Target Name NADPH oxidase 2 (CYBB)
Synonyms p22 phagocyte Bcytochrome; p22 phagocyte B-cytochrome; gp91phox; gp911; gp91-phox; gp91-1; Superoxidegenerating NADPH oxidase heavy chain subunit; Superoxide-generating NADPH oxidase heavy chain subunit; Neutrophil cytochrome b 91 kDa polypeptide; NOX2; Hemebinding membrane glycoprotein gp91phox; Heme-binding membrane glycoprotein gp91phox; Cytochrome b558 subunit beta; Cytochrome b245 heavy chain; Cytochrome b-245 heavy chain; Cytochrome b(558) subunit beta; CGD91phox; CGD91-phox
Target Type Literature-reported Target
Gene Name CYBB
Biochemical Class Phagocyte NADPH oxidase
UniProt ID
CY24B_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name Signal transducer and activator of transcription 1 (STAT1) homodimer
Classification Superclass beta-Scaffold Factors with Minor Groove Contacts
Class Signal transducer and activator of transcription
Family Signal transducer and activator of transcription
Regulation Mechanism IFN-gamma induces transcription of the CYBB gene by the cooperation of STAT1alpha and IRF1 binding to -100GAS and -88ISRE, respectively. [1]
Evidence Score (E-score) 2 +
1 Electrophoretic Mobility Shift Assay [1]
2 Luciferase Reporter Assay [2]
UniProt ID
STAT1_HUMAN
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNR
EHETNGVAKSDQKQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWK
RRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQV
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAE
PRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEVSRIVGSVEFDSMMNTV
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Cytokines / Cytokine receptors [+] 2 Cytokines / Cytokine receptors Co-regulated By This TF +
1 CD40L receptor (CD40) Clinical trial Target Target Info [3]
2 Interleukin 2 receptor alpha (IL2RA) Successful Target Target Info [4]
Immunoglobulins [+] 1 Immunoglobulins Co-regulated By This TF +
1 Intercellular adhesion molecule ICAM-1 (ICAM1) Successful Target Target Info [5]
Oxidoreductases [+] 1 Oxidoreductases Co-regulated By This TF +
1 NADPH oxidase 2 (CYBB) Literature-reported Target Target Info [1]
Transcription factors [+] 2 Transcription factors Co-regulated By This TF +
1 Interferon regulatory factor 1 (IRF1) Literature-reported Target Target Info [6]
2 Signal transducer and activator of transcription 1 (STAT1) Patented-recorded Target Target Info [6]
References  Top
REF 1 Cooperation of STAT-1 and IRF-1 in interferon-gamma-induced transcription of the gp91(phox) gene. J Biol Chem. 2002 Mar 15;277(11):9103-11.
REF 2 The human caspase-8 promoter sustains basal activity through SP1 and ETS-like transcription factors and can be up-regulated by a p53-dependent mechanism. J Biol Chem. 2003 Jul 25;278(30):27593-604.
REF 3 IL-4-activated STAT-6 inhibits IFN-gamma-induced CD40 gene expression in macrophages/microglia. J Immunol. 2000 Dec 1;165(11):6235-43.
REF 4 Interferon-alpha activates multiple STAT proteins and upregulates proliferation-associated IL-2Ralpha, c-myc, and pim-1 genes in human T cells. Blood. 1999 Mar 15;93(6):1980-91.
REF 5 Stat1 depends on transcriptional synergy with Sp1. J Biol Chem. 1995 Dec 22;270(51):30264-7.
REF 6 Isolation and characterization of a human STAT1 gene regulatory element. Inducibility by interferon (IFN) types I and II and role of IFN regulatory... J Biol Chem. 2002 May 31;277(22):19408-17.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.