Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T33976 | Target Info | |||
| Target Name | Transferrin receptor protein 1 (TFRC) | ||||
| Synonyms | Trfr; TfR1; TfR; TR protein; T9; P90; CD71 antigen; CD71 | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | TFRC | ||||
| Biochemical Class | Peptidase | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | Hypoxia-inducible factor 1A/1B (HIF-1) heterodimer | ||||
| Classification | Superclass | Basic Domains | |||
| Class | Tal/Twist/Atonal/Hen | ||||
| Family | Factors with PAS domain | ||||
| Regulation Mechanism | Transient co-expression of the twoHIF-1 subunits (HIF-1alpha andHIF-1beta) enhances the wild type TFRC promoteractivity, but that which contains a mutated HBS yields no such response. | [1] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay | [1] | |||
| UniProt ID | |||||
| Sequence |
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Endothelins/sarafotoxins | [+] 1 Endothelins/sarafotoxins Co-regulated By This TF | + | |||
| 1 | Endothelin-1 (EDN1) | Literature-reported Target | Target Info | [2] | |
| Growth factors | [+] 1 Growth factors Co-regulated By This TF | + | |||
| 1 | Vascular endothelial growth factor A (VEGFA) | Successful Target | Target Info | [3] | |
| Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
| 1 | Erythropoietin (EPO) | Clinical trial Target | Target Info | [4] | |
| Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
| 1 | Transferrin receptor protein 1 (TFRC) | Clinical trial Target | Target Info | [1] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | Identification of a hypoxia response element in the transferrin receptor gene. J Biol Chem. 1999 Aug 20;274(34):24147-52. | ||||
| REF 2 | Molecular regulation of the endothelin-1 gene by hypoxia. Contributions of hypoxia-inducible factor-1, activator protein-1, GATA-2, AND p300/CBP. J Biol Chem. 2001 Apr 20;276(16):12645-53. | ||||
| REF 3 | Identification of hypoxia-inducible factor 1 ancillary sequence and its function in vascular endothelial growth factor gene induction by hypoxia an... J Biol Chem. 2001 Jan 19;276(3):2292-8. | ||||
| REF 4 | Transitional change in interaction between HIF-1 and HNF-4 in response to hypoxia. J Hum Genet. 1999;44(5):293-9. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.