Target Regulator(s) Information (Transcription Factor)

Content Navigation (  All   None )                                      
Target General Information
The Transcription Factors (TFs) Regulating This Target
References
Target General Information  Top
Target ID T31186 Target Info
Target Name Eukaryotic initiation factor 4E (EIF4E)
Synonyms eIF4F 25 kDa subunit; eIF4E; eIF-4F 25 kDa subunit; eIF-4E; Eukaryotic translation initiation factor 4E; EIF4F; EIF4EL1
Target Type Literature-reported Target
Gene Name EIF4E
UniProt ID
IF4E_HUMAN
The Transcription Factors (TFs) Regulating This Target  Top
TF Name c-Myc proto-oncogene (MYC)
Classification Superclass Basic Domains
Class Helix-loop-helix / leucine zipper factors (bHLH-ZIP)
Family Cell-cycle controlling factors
Subfamily Myc
Regulation Mechanism A minimal, functional, 403-nucleotide promoter region of eIF4E was found to contain CACGTG E box repeats, and this core EIF4E promoter was myc responsive in cotransfections with c-myc. [1]
Evidence Score (E-score) 2 +
1 Chloramphenicol Acetyltransferase Assay, Electrophoretic Mobility Shift Assay [1]
2 Chromatin Immunoprecipitation Assay [2]
UniProt ID
MYC_HUMAN
Sequence
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLSSTESSPQGSPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDTEENVKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEEDLL
RKRREQLKHKLEQLRNSCA
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes
Eukaryotic initiation factors [+] 1 Eukaryotic initiation factors Co-regulated By This TF +
1 Eukaryotic initiation factor 4E (EIF4E) Literature-reported Target Target Info [1]
G protein-coupled receptors [+] 1 G protein-coupled receptors Co-regulated By This TF +
1 C-X-C chemokine receptor type 4 (CXCR4) Successful Target Target Info [3]
Kinases [+] 2 Kinases Co-regulated By This TF +
1 Erbb2 tyrosine kinase receptor (HER2) Successful Target Target Info [4]
2 Telomerase reverse transcriptase (TERT) Clinical trial Target Target Info [5]
Lyases [+] 1 Lyases Co-regulated By This TF +
1 Ornithine decarboxylase (ODC1) Successful Target Target Info [6]
Transcription factors [+] 1 Transcription factors Co-regulated By This TF +
1 Transcription factor E2F2 (E2F2) Literature-reported Target Target Info [7]
References  Top
REF 1 An essential E box in the promoter of the gene encoding the mRNA cap-binding protein (eukaryotic initiation factor 4E) is a target for activation by c-myc. Mol Cell Biol. 1996 Sep;16(9):4754-64.
REF 2 MYC directs transcription of MCL1 and eIF4E genes to control sensitivity of gastric cancer cells toward HDAC inhibitors. Cell Cycle. 2012 Apr 15;11(8):1593-602.
REF 3 USF/c-Myc enhances, while Yin-Yang 1 suppresses, the promoter activity of CXCR4, a coreceptor for HIV-1 entry. J Immunol. 1999 May 15;162(10):5986-92.
REF 4 c-myc reverses neu-induced transformed morphology by transcriptional repression. Mol Cell Biol. 1991 Jan;11(1):354-62.
REF 5 Sp1 cooperates with c-Myc to activate transcription of the human telomerase reverse transcriptase gene (hTERT). Nucleic Acids Res. 2000 Feb 1;28(3):669-77.
REF 6 The ornithine decarboxylase gene is a transcriptional target of c-Myc. Proc Natl Acad Sci U S A. 1993 Aug 15;90(16):7804-8.
REF 7 Identification of positively and negatively acting elements regulating expression of the E2F2 gene in response to cell growth signals. Mol Cell Biol. 1997 Sep;17(9):5227-35.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.