Target Regulator(s) Information (Transcription Factor)
| Target General Information | Top | ||||
|---|---|---|---|---|---|
| Target ID | T10513 | Target Info | |||
| Target Name | Integrin beta-2 (ITGB2) | ||||
| Synonyms | MFI7; Integrin alpha-M/beta-2; Complement receptor C3 subunit beta; Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; CD18 | ||||
| Target Type | Clinical trial Target | ||||
| Gene Name | ITGB2 | ||||
| Biochemical Class | Integrin | ||||
| UniProt ID | |||||
| The Transcription Factors (TFs) Regulating This Target | Top | ||||
|---|---|---|---|---|---|
| TF Name | PU.1 proto-oncogene (SPI1) | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Tryptophan clusters | ||||
| Family | Ets-type | ||||
| Regulation Type | Increase | ||||
| Evidence Score (E-score) | 2 | + | |||
| 1 | DNase I Footprint Analysis, Electrophoretic Mobility Shift Assay | [1] | |||
| 2 | Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [2] | |||
| UniProt ID | |||||
| Sequence |
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE VKKVKKKLTYQFSGEVLGRGGLAERRHPPH |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cytokines / Cytokine receptors | [+] 4 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | CD40L receptor (CD40) | Clinical trial Target | Target Info | [3] | |
| 2 | Granulocyte colony-stimulating factor receptor (G-CSF-R) | Successful Target | Target Info | [4] | |
| 3 | Interleukin-1 beta (IL1B) | Successful Target | Target Info | [5] | |
| 4 | Interleukin-12 beta (IL12B) | Successful Target | Target Info | [6] | |
| Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
| 1 | Integrin beta-2 (ITGB2) | Clinical trial Target | Target Info | [1] | |
| TF Name | GA-binding protein (GABP) heterotetramer | ||||
| Classification | Superclass | Helix-turn-helix | |||
| Class | Tryptophan clusters | ||||
| Family | Ets-type | ||||
| Regulation Type | Increase | ||||
| Regulation Mechanism | The human ITGB2 promoter consists of two inverted Ets cis elements; one is related to GABP, and the other is related to PU.1/Spi-1. | [2] | |||
| Evidence Score (E-score) | 1 | + | |||
| 1 | Electrophoretic Mobility Shift Assay, DNase I Footprint Analysis | [2] | |||
| UniProt ID | |||||
| Sequence |
MTKREAEELIEIEIDGTEKAECTEESIVEQTYAPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPERSLFDQGVKTDGTVQLSVQVISYQGIEPKLNILEIVKPADTV EVVIDPDAHHAESEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL GIPYDPIQWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVQSATPTTIKVINSSAKAAKVQRAP RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVTE CEQKKLAKMQLHGIAQPVTAVALATASLQTEKDN |
||||
| The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
| Cytokines / Cytokine receptors | [+] 1 Cytokines / Cytokine receptors Co-regulated By This TF | + | |||
| 1 | Interleukin 2 receptor beta (IL2RB) | Clinical trial Target | Target Info | [7] | |
| Integrins | [+] 1 Integrins Co-regulated By This TF | + | |||
| 1 | Integrin beta-2 (ITGB2) | Clinical trial Target | Target Info | [2] | |
| Peptidases | [+] 1 Peptidases Co-regulated By This TF | + | |||
| 1 | Coagulation factor IX (F9) | Successful Target | Target Info | [8] | |
| Zinc-fingers | [+] 1 Zinc-fingers Co-regulated By This TF | + | |||
| 1 | Utrophin (UTRN) | Clinical trial Target | Target Info | [9] | |
| References | Top | ||||
|---|---|---|---|---|---|
| REF 1 | CD18 (beta 2 leukocyte integrin) promoter requires PU.1 transcription factor for myeloid activity. Proc Natl Acad Sci U S A. 1995 Jan 31;92(3):801-5. | ||||
| REF 2 | The human beta 2 integrin CD18 promoter consists of two inverted Ets cis elements. Mol Cell Biol. 1994 Apr;14(4):2604-15. | ||||
| REF 3 | IL-4-activated STAT-6 inhibits IFN-gamma-induced CD40 gene expression in macrophages/microglia. J Immunol. 2000 Dec 1;165(11):6235-43. | ||||
| REF 4 | PU.1 (Spi-1) and C/EBP alpha regulate the granulocyte colony-stimulating factor receptor promoter in myeloid cells. Blood. 1996 Aug 15;88(4):1234-47. | ||||
| REF 5 | Monocyte expression of the human prointerleukin 1 beta gene (IL1B) is dependent on promoter sequences which bind the hematopoietic transcription fa... Mol Cell Biol. 1995 Jan;15(1):58-68. | ||||
| REF 6 | Identification and characterization of a novel Ets-2-related nuclear complex implicated in the activation of the human interleukin-12 p40 gene prom... J Biol Chem. 1997 Apr 18;272(16):10389-95. | ||||
| REF 7 | Characterization of the human interleukin-2 receptor beta-chain gene promoter: regulation of promoter activity by ets gene products. Mol Cell Biol. 1993 Oct;13(10):6201-10. | ||||
| REF 8 | Binding of the Ets factor GA-binding protein to an upstream site in the factor IX promoter is a critical event in transactivation. Mol Cell Biol. 1996 May;16(5):1929-35. | ||||
| REF 9 | Induction of utrophin gene expression by heregulin in skeletal muscle cells: role of the N-box motif and GA binding protein. Proc Natl Acad Sci U S A. 1999 Mar 16;96(6):3223-7. | ||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.