Target Regulator(s) Information (Transcription Factor)
Target General Information | Top | ||||
---|---|---|---|---|---|
Target ID | T08898 | Target Info | |||
Target Name | Melanocortin receptor 2 (MC2R) | ||||
Synonyms | Melanocortin-2 receptor; MC2-R; Adrenocorticotropin receptor; Adrenocorticotropic hormone receptor; ACTHR; ACTH-R; ACTH receptor | ||||
Target Type | Successful Target | ||||
Gene Name | MC2R | ||||
Biochemical Class | GPCR rhodopsin | ||||
UniProt ID |
The Transcription Factors (TFs) Regulating This Target | Top | ||||
---|---|---|---|---|---|
TF Name | Steroidogenic factor 1 (STF1) | ||||
Classification | Superclass | Zinc-coordinating DNA-binding domains | |||
Class | Cys4 zinc finger of nuclear receptor type | ||||
Regulation Mechanism | The STF binding sites locate in the promoter of the MC2R gene, and therefore regulate the MC2R expression. | [1] | |||
Evidence Score (E-score) | 2 | + | |||
1 | Luciferase Reporter Assay, Electrophoretic Mobility Shift Assay | [1] | |||
2 | Reporter Assay | [2] | |||
UniProt ID | |||||
Sequence |
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL ETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPL AGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLA LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT |
||||
The Genes (Co-regulated by This TF) Grouped Based on Their Biochemical Classes | |||||
G protein-coupled receptors | [+] 1 G protein-coupled receptors Co-regulated By This TF | + | |||
1 | Melanocortin receptor 2 (MC2R) | Successful Target | Target Info | [1] | |
Hormones | [+] 1 Hormones Co-regulated By This TF | + | |||
1 | Insulin (INS) | Successful Target | Target Info | [3] | |
Oxidoreductases | [+] 1 Oxidoreductases Co-regulated By This TF | + | |||
1 | Cholesterol desmolase (CYP11A1) | Successful Target | Target Info | [4] |
References | Top | ||||
---|---|---|---|---|---|
REF 1 | Three steroidogenic factor-1 binding elements are required for constitutive and cAMP-regulated expression of the human adrenocorticotropin receptor gene. Biochem Biophys Res Commun. 1999 Feb 5;255(1):28-33. | ||||
REF 2 | Pre-B-cell transcription factor 1 and steroidogenic factor 1 synergistically regulate adrenocortical growth and steroidogenesis. Endocrinology. 2007 Feb;148(2):693-704. | ||||
REF 3 | Glucose rapidly and reversibly decreases INS-1 cell insulin gene transcription via decrements in STF-1 and C1 activator transcription factor activity. Mol Endocrinol. 1998 Feb;12(2):207-19. | ||||
REF 4 | Regulatory mechanisms of cAMP-dependent and cell-specific expression of human steroidogenic cytochrome P450scc (CYP11A1) gene. Eur J Biochem. 1994 Jun 15;222(3):825-34. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.