Resistance mutation info of drug
| Drug General Information | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Drug ID | D01WJL | ||||||||||
| Drug Name | Aminosalicylic Acid | ||||||||||
| Synonyms | 4-Aminosalicylic acid; 65-49-6; Aminosalicylic acid; P-AMINOSALICYLIC ACID; Rezipas; Aminopar; Pamisyl; Parasalindon; Ferrosan; Deapasil; Apacil; Parasal; Paser; Paramycin; Gabbropas; Parasalicil; Pasnodia; Osacyl; Aminox; Pasolac; Pasmed; Propasa; Pasalon; Entepas; Pasdium; Pasara; Pamacyl; Pasem; Pasa; 2-Hydroxy-4-aminobenzoic acid; PASK; APAS; Para-Pas; Sanipirol-4; Hellipidyl; Pascorbic; PAS-C; Benzoic acid, 4-amino-2-hydroxy-; PAS (acid); Aminosalicylic Acid Resin Complex; Aminosalicylate Sodium | ||||||||||
| Drug Type | Small molecular drug | ||||||||||
| Company | Panray Corp Sub Ormont Drug And Chemical Co Inc | ||||||||||
| Structure |
|
||||||||||
| Drug Resistance Mutations | |||||||||||
| Target Name | Bacterial Thymidylate synthase (thyA) | Target Info | |||||||||
| Gene Name | thyA | ||||||||||
| Uniprot ID | TYSY_MYCTU | ||||||||||
| Species | Mycobacterium tuberculosis | ||||||||||
| Reference Sequence |
MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELL WFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLR TDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIAS YALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFE YTYEDIVVKNYDPHPAIKAPVAV [Mycobacterium tuberculosis] |
||||||||||
| Targeted Disease | Tuberculosis | ||||||||||
| Drug Resistance Mutations |
|
||||||||||
|
|||||||||||
| References | |||||||||||
| REF 1 | The folate pathway is a target for resistance to the drug para-aminosalicylic acid (PAS) in mycobacteria. Mol Microbiol. 2004 Jul;53(1):275-82. | ||||||||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.