Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T71342
(Former ID: TTDR01365)
|
|||||
Target Name |
Human papillomavirus-18 E7 region messenger RNA (HPV-18 E7 mRNA)
|
|||||
Synonyms |
HPV-18 protein E7 (mRNA); HPV-18 E7 (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
HPV-18 E7 mRNA
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta). Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHT
MLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ Click to Show/Hide
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | US patent application no. 5,457,189, Antisense oligonucleotide inhibition of papillomavirus. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.