Target General Infomation
Target ID
T68547 (Former ID: TTDS00095)
Target Name
Histone deacetylase 1 (HDAC1)
Synonyms
RPD3L1; HD1
Gene Name
HDAC1
Target Type
Successful target
[1]
Disease [+] 2 Target-related Diseases +
1 Multiple myeloma [ICD-11: 2A83]
2 Mycosis fungoides [ICD-11: 2B01]
Function
Gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is released from the complex and CREBBP is recruited, which facilitates transcriptional activation. Deacetylates TSHZ3 and regulates its transcriptional repressor activity. Deacetylates 'Lys-310' in RELA and thereby inhibits the transcriptional activity of NF-kappa-B. Deacetylates NR1D2 and abrogates the effect of KAT5-mediated relieving of NR1D2 transcription repression activity. Component of a RCOR/GFI/KDM1A/HDAC complex that suppresses, via histone deacetylase (HDAC) recruitment, a number of genes implicated in multilineage blood cell development. Involved in CIART-mediated transcriptional repression of the circadian transcriptional activator: CLOCK-ARNTL/BMAL1 heterodimer. Required for the transcriptional repression of circadian target genes, such as PER1, mediated by the large PER complex or CRY1 through histone deacetylation. Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4).
BioChemical Class
Carbon-nitrogen hydrolase
UniProt ID
HDAC1_HUMAN
EC Number
EC 3.5.1.98
Sequence
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
Drugs and Modes of Action
Approved Drug(s) [+] 4 Approved Drugs +
1 Panobinostat Drug Info Approved Multiple myeloma [2]
2 Romidepsin Drug Info Approved Cutaneous T-cell lymphoma [3], [4]
3 Vorinostat Drug Info Approved Cutaneous T-cell lymphoma [5], [6]
4 HBI-8000 Drug Info Registered Solid tumour/cancer [7], [8]
Clinical Trial Drug(s) [+] 12 Clinical Trial Drugs +
1 ITF2357 Drug Info Phase 3 Duchenne dystrophy [9]
2 NVP-LAQ824 Drug Info Phase 3 Mood disorder [10]
3 SNDX-275 Drug Info Phase 3 Breast cancer [11]
4 MGCD-0103 Drug Info Phase 2 Solid tumour/cancer [12], [13]
5 Phenylbutyrate Drug Info Phase 2 Urea cycle disorder [14], [15]
6 Resminostat Drug Info Phase 2 Hepatocellular carcinoma [16], [17]
7 SB-623 Drug Info Phase 2 Cerebrovascular ischaemia [18]
8 Sodium butyrate Drug Info Phase 2 Refractory sickle cell ulcers [19]
9 CHR-3996 Drug Info Phase 1 Solid tumour/cancer [20], [21]
10 OBP-801 Drug Info Phase 1 Solid tumour/cancer [22]
11 RG-2833 Drug Info Phase 1 Friedreich's ataxia [23], [24]
12 SB-639 Drug Info Phase 1 Solid tumour/cancer [25]
Discontinued Drug(s) [+] 4 Discontinued Drugs +
1 AN-9 Drug Info Discontinued in Phase 2 Melanoma [26]
2 Tacedinaline Drug Info Discontinued in Phase 2 Solid tumour/cancer [27], [28]
3 Pyroxamide Drug Info Discontinued in Phase 1 Solid tumour/cancer [29]
4 Oxamflatin Drug Info Terminated Solid tumour/cancer [36]
Preclinical Drug(s) [+] 8 Preclinical Drugs +
1 4SC-202 Drug Info Preclinical Solid tumour/cancer [17]
2 Chlamydocin Drug Info Preclinical Solid tumour/cancer [30]
3 Depudecin Drug Info Preclinical Solid tumour/cancer [31]
4 HC-Toxin Drug Info Preclinical Solid tumour/cancer [32]
5 M-carboxycinnamic acid bishydroxamide Drug Info Preclinical Solid tumour/cancer [33]
6 Scriptaid Drug Info Preclinical Solid tumour/cancer [15], [34]
7 SK-7041 Drug Info Preclinical Solid tumour/cancer [35]
8 SK-7068 Drug Info Preclinical Solid tumour/cancer [35]
Mode of Action [+] 2 Modes of Action +
Inhibitor [+] 248 Inhibitor drugs +
1 Panobinostat Drug Info [1], [37], [38], [39]
2 Romidepsin Drug Info [4]
3 Vorinostat Drug Info [1], [40], [39]
4 ITF2357 Drug Info [42], [6]
5 NVP-LAQ824 Drug Info [43]
6 MGCD-0103 Drug Info [1], [38], [39]
7 Phenylbutyrate Drug Info [15]
8 Resminostat Drug Info [17]
9 SB-623 Drug Info [38]
10 SNDX-275 Drug Info [6]
11 Sodium butyrate Drug Info [39], [44]
12 CHR-3996 Drug Info [21]
13 OBP-801 Drug Info [45]
14 SB-639 Drug Info [38]
15 Diaryl amine derivative 2 Drug Info [46]
16 Diaryl amine derivative 3 Drug Info [46]
17 Isosteric imidazolyl pyrimidine derivative 1 Drug Info [47]
18 PMID28092474-Compound-32a Drug Info [46]
19 PMID28092474-Compound-32b Drug Info [46]
20 PMID28092474-Compound-32c Drug Info [46]
21 PMID28092474-Compound-32d Drug Info [46]
22 PMID28092474-Compound-32e Drug Info [46]
23 PMID28092474-Compound-32f Drug Info [46]
24 PMID28092474-Compound-32g Drug Info [46]
25 PMID28092474-Compound-32h Drug Info [46]
26 PMID28092474-Compound-32i Drug Info [46]
27 PMID28092474-Compound-32j Drug Info [46]
28 PMID28092474-Compound-32k Drug Info [46]
29 PMID28092474-Compound-32l Drug Info [46]
30 PMID28092474-Compound-32m Drug Info [46]
31 PMID28092474-Compound-32n Drug Info [46]
32 PMID28092474-Compound-32o Drug Info [46]
33 PMID28092474-Compound-32p Drug Info [46]
34 PMID28092474-Compound-32q Drug Info [46]
35 PMID28092474-Compound-32r Drug Info [46]
36 PMID28092474-Compound-32s Drug Info [46]
37 PMID28092474-Compound-32t Drug Info [46]
38 PMID28092474-Compound-32u Drug Info [46]
39 PMID28092474-Compound-32v Drug Info [46]
40 PMID28092474-Compound-32x Drug Info [46]
41 PMID28092474-Compound-32y Drug Info [46]
42 PMID28092474-Compound-32z Drug Info [46]
43 PMID28092474-Compound-33a Drug Info [46]
44 PMID28092474-Compound-33b Drug Info [46]
45 PMID28092474-Compound-33c Drug Info [46]
46 PMID28092474-Compound-33d Drug Info [46]
47 PMID28092474-Compound-33e Drug Info [46]
48 PMID28092474-Compound-33f Drug Info [46]
49 PMID28092474-Compound-33g Drug Info [46]
50 PMID28092474-Compound-33h Drug Info [46]
51 PMID28092474-Compound-33i Drug Info [46]
52 PMID28092474-Compound-33j Drug Info [46]
53 PMID28092474-Compound-33k Drug Info [46]
54 PMID28092474-Compound-33l Drug Info [46]
55 PMID28092474-Compound-33m Drug Info [46]
56 PMID28092474-Compound-33o Drug Info [46]
57 PMID28092474-Compound-33p Drug Info [46]
58 PMID28092474-Compound-34a Drug Info [46]
59 PMID28092474-Compound-34b Drug Info [46]
60 PMID28092474-Compound-34c Drug Info [46]
61 PMID29671355-Compound-11 Drug Info [48]
62 PMID29671355-Compound-13 Drug Info [48]
63 PMID29671355-Compound-18 Drug Info [48]
64 PMID29671355-Compound-19 Drug Info [48]
65 PMID29671355-Compound-21 Drug Info [48]
66 PMID29671355-Compound-22 Drug Info [48]
67 PMID29671355-Compound-23 Drug Info [48]
68 PMID29671355-Compound-24 Drug Info [48]
69 PMID29671355-Compound-25 Drug Info [48]
70 PMID29671355-Compound-26 Drug Info [48]
71 PMID29671355-Compound-27 Drug Info [48]
72 PMID29671355-Compound-28 Drug Info [48]
73 PMID29671355-Compound-31 Drug Info [48]
74 PMID29671355-Compound-38a Drug Info [48]
75 PMID29671355-Compound-38b Drug Info [48]
76 PMID29671355-Compound-39 Drug Info [48]
77 PMID29671355-Compound-42 Drug Info [48]
78 PMID29671355-Compound-43 Drug Info [48]
79 PMID29671355-Compound-44 Drug Info [48]
80 PMID29671355-Compound-55 Drug Info [48]
81 PMID29671355-Compound-56 Drug Info [48]
82 PMID29671355-Compound-57 Drug Info [48]
83 PMID29671355-Compound-59 Drug Info [48]
84 PMID29671355-Compound-61 Drug Info [48]
85 PMID29671355-Compound-62 Drug Info [48]
86 PMID29671355-Compound-65a Drug Info [48]
87 PMID29671355-Compound-67 Drug Info [48]
88 PMID29671355-Compound-73 Drug Info [48]
89 PMID29671355-Compound-8 Drug Info [48]
90 PMID29671355-Compound-9 Drug Info [48]
91 AN-9 Drug Info [39]
92 Tacedinaline Drug Info [38], [39]
93 Pyroxamide Drug Info [38], [39]
94 4SC-202 Drug Info [17]
95 Chlamydocin Drug Info [38]
96 Depudecin Drug Info [38], [39]
97 HC-Toxin Drug Info [38]
98 M-carboxycinnamic acid bishydroxamide Drug Info [38], [39]
99 Scriptaid Drug Info [38], [15], [39]
100 SK-7041 Drug Info [38], [39]
101 SK-7068 Drug Info [38], [39]
102 Oxamflatin Drug Info [38], [39]
103 (E)-8-Biphenyl-4-yl-1-oxazol-2-yl-oct-7-en-1-one Drug Info [49]
104 1,1,1-Trifluoro-8-(4-phenoxy-phenoxy)-octan-2-one Drug Info [50]
105 1,1,1-Trifluoro-8-phenoxy-octan-2-one Drug Info [50]
106 2-(methylsulfonylthio)ethyl 2-propylpentanoate Drug Info [51]
107 4-Benzenesulfonylamino-N-hydroxy-benzamide Drug Info [52]
108 4-Benzoylamino-N-hydroxy-benzamide Drug Info [53]
109 4-Butyrylamino-N-hydroxy-benzamide Drug Info [54]
110 4-Chloro-N-(5-hydroxycarbamoyl-pentyl)-benzamide Drug Info [55]
111 4-Dimethylamino-N-(6-mercapto-hexyl)-benzamide Drug Info [56]
112 4-Hydroxy-N-(5-hydroxycarbamoyl-pentyl)-benzamide Drug Info [57]
113 4-Phenylbutyrohydroxamic acid Drug Info [58]
114 4-tert-butyl-N-hydroxybenzamide Drug Info [59]
115 5-(4-Chloro-phenyl)-pentanoic acid hydroxyamide Drug Info [60]
116 5-(4-hydroxyphenyl)-3H-1,2-dithiole-3-thione Drug Info [51]
117 5-Mercapto-pentanoic acid phenylamide Drug Info [56]
118 6-(2-Bromo-acetylamino)-hexanoic acid phenylamide Drug Info [56]
119 6-(3-Benzoyl-ureido)-hexanoic acid hydroxyamide Drug Info [61]
120 6-(9H-carbazol-9-yl)-N-hydroxyhexanamide Drug Info [62]
121 6-benzenesulfinylhexanoic acid hydroxamide Drug Info [63]
122 6-benzenesulfonylhexanoic acid hydroxamide Drug Info [63]
123 6-Mercapto-hexanoic acid phenylamide Drug Info [56]
124 6-Phenoxy-hexane-1-thiol Drug Info [56]
125 6-phenylsulfanylhexanoic acid hydroxamide Drug Info [63]
126 7-(1H-indol-5-yloxy)-N-hydroxyheptanamide Drug Info [64]
127 7-(3-Benzoyl-ureido)-heptanoic acid hydroxyamide Drug Info [61]
128 7-(4-(dimethylamino)phenoxy)-N-hydroxyheptanamide Drug Info [64]
129 7-(Biphenyl-3-yloxy)-1-oxazol-2-yl-heptan-1-one Drug Info [49]
130 7-(Biphenyl-4-yloxy)-1,1,1-trifluoro-heptan-2-one Drug Info [50]
131 7-(Biphenyl-4-yloxy)-1-oxazol-2-yl-heptan-1-one Drug Info [49]
132 7-(Biphenyl-4-yloxy)-heptanoic acid hydroxyamide Drug Info [65]
133 7-(Naphthalen-2-yloxy)-1-oxazol-2-yl-heptan-1-one Drug Info [49]
134 7-Biphenyl-4-yl-heptanoic acid hydroxyamide Drug Info [66]
135 7-Mercapto-heptanoic acid benzothiazol-2-ylamide Drug Info [56]
136 7-Mercapto-heptanoic acid biphenyl-3-ylamide Drug Info [56]
137 7-Mercapto-heptanoic acid biphenyl-4-ylamide Drug Info [56]
138 7-Mercapto-heptanoic acid phenylamide Drug Info [56]
139 7-Mercapto-heptanoic acid pyridin-3-ylamide Drug Info [56]
140 7-Mercapto-heptanoic acid quinolin-3-ylamide Drug Info [56]
141 7-mercapto-N-(4-phenylthiazol-2-yl)heptanamide Drug Info [67]
142 7-Phenoxy-heptanoic acid hydroxyamide Drug Info [66]
143 8-(3-Benzoyl-ureido)-octanoic acid hydroxyamide Drug Info [61]
144 8-(4-bromophenyl)-N-hydroxy-8-oxooctanamide Drug Info [68]
145 8-(Biphenyl-3-yloxy)-1,1,1-trifluoro-octan-2-one Drug Info [50]
146 8-(biphenyl-4-yl)-N-hydroxy-8-oxooctanamide Drug Info [68]
147 8-(Biphenyl-4-yloxy)-1,1,1-trifluoro-octan-2-one Drug Info [50]
148 8-(Biphenyl-4-yloxy)-2-oxo-octanoic acid Drug Info [65]
149 8-Mercapto-octanoic acid phenylamide Drug Info [56]
150 8-Oxo-8-phenyl-octanoic acid Drug Info [57]
151 8-Oxo-8-phenyl-octanoic acid hydroxyamide Drug Info [55]
152 8-Phenyl-octanoic acid hydroxyamide Drug Info [66]
153 9,9,9-Trifluoro-8-oxo-nonanoic acid phenylamide Drug Info [50]
154 9-(Biphenyl-4-yloxy)-1,1,1-trifluoro-nonan-2-one Drug Info [50]
155 ADS-100380 Drug Info [69]
156 ADS-102550 Drug Info [69]
157 Azithromycin-N-benzyltriazolyldecahydroxamic Acid Drug Info [70]
158 Azithromycin-N-benzyltriazolylhexahydroxamic Acid Drug Info [70]
159 Azithromycin-N-benzyltriazolylnonahydroxamic Acid Drug Info [70]
160 Azithromycin-N-benzyltriazolyloctahydroxamic Acid Drug Info [70]
161 Azithromycinarylalkylhydroxamic Acid Drug Info [70]
162 AZUMAMIDE B Drug Info [71]
163 AZUMAMIDE C Drug Info [71]
164 AZUMAMIDE E Drug Info [71]
165 Cyclo(-L-Am7(S2Py)-A2in-L-Ala-D-Pro-) Drug Info [72]
166 Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Pro-) Drug Info [72]
167 Cyclo(-L-Am7(S2Py)-Aib-L-Ala-D-Tic-) Drug Info [72]
168 Cyclo(-L-Am7(S2Py)-Aib-L-Ph4-D-Pro-) Drug Info [72]
169 Cyclo(-L-Am7(S2Py)-Aib-L-Ph5-D-Pro-) Drug Info [72]
170 Cyclo(-L-Am7(S2Py)-Aib-L-Phe-D-Pro-) Drug Info [72]
171 Cyclo(-L-Am7(S2Py)-Aib-L-Phg-D-Pro-) Drug Info [72]
172 Cyclo(-L-Am7(S2Py)-Aib-L-Ser(Bzl)-D-Pro-) Drug Info [72]
173 Cyclo(-L-Am7(S2Py)-Aib-L-Ser-D-Pro-) Drug Info [72]
174 Cyclo(-L-Am7(S2Py)-D-2MePhe-L-Ala-D-Pro-) Drug Info [72]
175 Cyclo(-L-Am7(S2Py)-D-A1in-L-Ala-D-Pro-) Drug Info [72]
176 Cyclo(-L-Am7(S2Py)-L-2MePhe-L-Ala-D-Pro-) Drug Info [72]
177 Cyclo(-L-Am7(S2Py)-L-A1in-L-Ala-D-Pro-) Drug Info [72]
178 Cyclostellettamine derivative Drug Info [73]
179 Desclasinose Azithromycinarylalkyl Hydroxamate Drug Info [70]
180 Gymnochrome E Drug Info [74]
181 LARGAZOLE Drug Info [76]
182 N,8-dihydroxy-8-(naphthalen-2-yl)octanamide Drug Info [68]
183 N-(2,3-Dimethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
184 N-(2,4-Dimethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
185 N-(2,5-Dimethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
186 N-(2,6-Dimethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
187 N-(2-amino-5-(thiophen-2-yl)phenyl)nicotinamide Drug Info [78]
188 N-(2-aminophenyl)-4-(chroman-3-ylmethyl)benzamide Drug Info [79]
189 N-(2-aminophenyl)-4-methoxybenzamide Drug Info [80]
190 N-(2-aminophenyl)nicotinamide Drug Info [78]
191 N-(2-aminophenyl)quinoxaline-6-carboxamide Drug Info [80]
192 N-(2-Ethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
193 N-(2-Mercapto-ethyl)-N'-phenyl-oxalamide Drug Info [81]
194 N-(2-Mercapto-ethyl)-N'-phenyl-succinamide Drug Info [81]
195 N-(3,4-Dimethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
196 N-(3,5-Dimethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
197 N-(3-Ethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
198 N-(4-aminobiphenyl-3-yl)nicotinamide Drug Info [78]
199 N-(4-Ethylphenyl)-N'-hydroxyoctanediamide Drug Info [77]
200 N-(4-hydroxybiphenyl-3-yl)benzamide Drug Info [78]
201 N-(5-Hydroxycarbamoyl-pentyl)-4-nitro-benzamide Drug Info [55]
202 N-(6-Hydroxycarbamoyl-hexyl)-benzamide Drug Info [57]
203 N-(6-Mercapto-hexyl)-benzamide Drug Info [56]
204 N-hydroxy-2,2'-bithiophene-5-carboxamide Drug Info [69]
205 N-Hydroxy-4-((R)-2-phenyl-butyrylamino)-benzamide Drug Info [53]
206 N-Hydroxy-4-((S)-2-phenyl-butyrylamino)-benzamide Drug Info [53]
207 N-Hydroxy-4-(2-phenyl-butyrylamino)-benzamide Drug Info [53]
208 N-Hydroxy-4-(3-phenyl-propionylamino)-benzamide Drug Info [82]
209 N-Hydroxy-4-(4-phenyl-butyrylamino)-benzamide Drug Info [53]
210 N-Hydroxy-4-(5-phenyl-pentanoylamino)-benzamide Drug Info [53]
211 N-Hydroxy-4-(pentanoylamino-methyl)-benzamide Drug Info [54]
212 N-Hydroxy-4-(phenylacetylamino-methyl)-benzamide Drug Info [54]
213 N-Hydroxy-4-phenylacetylamino-benzamide Drug Info [53]
214 N-hydroxy-5-(pyridin-2-yl)thiophene-2-carboxamide Drug Info [69]
215 N-hydroxy-5-(pyridin-3-yl)thiophene-2-carboxamide Drug Info [69]
216 N-hydroxy-5-(pyridin-4-yl)thiophene-2-carboxamide Drug Info [69]
217 N-hydroxy-5-phenylthiophene-2-carboxamide Drug Info [69]
218 N-hydroxy-6-oxo-6-phenylhexanamide Drug Info [68]
219 N-hydroxy-7-(4-methoxyphenyl)-7-oxoheptanamide Drug Info [68]
220 N-hydroxy-7-(naphthalen-2-yl)-7-oxoheptanamide Drug Info [68]
221 N-hydroxy-7-(naphthalen-2-yloxy)heptanamide Drug Info [64]
222 N-hydroxy-7-oxo-7-phenylheptanamide Drug Info [68]
223 N-hydroxy-8-(2-methoxyphenyl)-8-oxooctanamide Drug Info [68]
224 N-hydroxy-8-(4-methoxyphenyl)-8-oxooctanamide Drug Info [68]
225 N-hydroxy-8-(naphthalen-2-yl)non-8-enamide Drug Info [68]
226 N-hydroxy-8-(naphthalen-2-yl)oct-7-enamide Drug Info [68]
227 N-hydroxy-8-(naphthalen-2-yl)octanamide Drug Info [68]
228 N-hydroxy-8-oxo-8-(pyridin-3-yl)octanamide Drug Info [68]
229 N-hydroxy-9-oxo-9-phenylnonanamide Drug Info [68]
230 N-Hydroxy-N'-(2-methylphenyl)octanediamide Drug Info [77]
231 N-Hydroxy-N'-(3-methylphenyl)octanediamide Drug Info [77]
232 N-Hydroxy-N'-(4-methoxyphenyl)octanediamide Drug Info [77]
233 N-Hydroxy-N'-(4-methylphenyl)octanediamide Drug Info [77]
234 N-hydroxybenzo[b]thiophene-2-carboxamide Drug Info [83]
235 N1-(biphenyl-3-yl)-N8-hydroxyoctanediamide Drug Info [84]
236 N1-(biphenyl-4-yl)-N8-hydroxyoctanediamide Drug Info [85]
237 N1-hydroxy-N8-(4-phenylthiazol-2-yl)octanediamide Drug Info [85]
238 nexturastat A Drug Info [86]
239 NSC-746457 Drug Info [87]
240 Octanedioic acid bis-hydroxyamide Drug Info [88]
241 Octanedioic acid hydroxyamide pyridin-2-ylamide Drug Info [57]
242 Octanedioic acid hydroxyamide pyridin-4-ylamide Drug Info [57]
243 PSAMMAPLIN A Drug Info [55]
244 SK-683 Drug Info [89]
245 ST-2986 Drug Info [90]
246 ST-2987 Drug Info [90]
247 ST-3050 Drug Info [90]
248 Thioacetic acid S-(6-phenylcarbamoyl-hexyl) ester Drug Info [56]
Modulator [+] 3 Modulator drugs +
1 HBI-8000 Drug Info [41]
2 RG-2833 Drug Info [41]
3 histone deacetylase-1 inhibitors (cancer) Drug Info [75]
Target Regulators
Target-regulating microRNAs
Target-interacting Proteins
Target Profiles in Patients
Target Expression
 Profile (TEP)
Target Affiliated Biological Pathways
KEGG Pathway [+] 12 KEGG Pathways +
1 Cell cycle
2 Notch signaling pathway
3 Thyroid hormone signaling pathway
4 Huntington's disease
5 Amphetamine addiction
6 Alcoholism
7 Epstein-Barr virus infection
8 Pathways in cancer
9 Transcriptional misregulation in cancer
10 Viral carcinogenesis
11 MicroRNAs in cancer
12 Chronic myeloid leukemia
NetPath Pathway [+] 1 NetPath Pathways +
1 TCR Signaling Pathway
Panther Pathway [+] 2 Panther Pathways +
1 Wnt signaling pathway
2 p53 pathway
PID Pathway [+] 17 PID Pathways +
1 Regulation of nuclear SMAD2/3 signaling
2 Notch signaling pathway
3 E2F transcription factor network
4 Presenilin action in Notch and Wnt signaling
5 Signaling events mediated by HDAC Class I
6 Regulation of Telomerase
7 Glucocorticoid receptor regulatory network
8 Sumoylation by RanBP2 regulates transcriptional repression
9 Regulation of Androgen receptor activity
10 IL3-mediated signaling events
11 Validated nuclear estrogen receptor alpha network
12 Retinoic acid receptors-mediated signaling
13 Hedgehog signaling events mediated by Gli proteins
14 Regulation of nuclear beta catenin signaling and target gene transcription
15 Validated targets of C-MYC transcriptional repression
16 Regulation of retinoblastoma protein
17 Notch-mediated HES/HEY network
Reactome [+] 12 Reactome Pathways +
1 G0 and Early G1
2 p75NTR negatively regulates cell cycle via SC1
3 Formation of the beta-catenin:TCF transactivating complex
4 NOTCH1 Intracellular Domain Regulates Transcription
5 SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
6 Constitutive Signaling by NOTCH1 PEST Domain Mutants
7 Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
8 HDACs deacetylate histones
9 Deactivation of the beta-catenin transactivating complex
10 NoRC negatively regulates rRNA expression
11 RNA Polymerase I Transcription Initiation
12 Factors involved in megakaryocyte development and platelet production
WikiPathways [+] 17 WikiPathways +
1 SIDS Susceptibility Pathways
2 Notch Signaling Pathway
3 TGF beta Signaling Pathway
4 IL-6 signaling pathway
5 Apoptosis-related network due to altered Notch3 in ovarian cancer
6 Transcriptional activity of SMAD2/SMAD3:SMAD4 heterotrimer
7 Notch Signaling Pathway
8 Retinoblastoma (RB) in Cancer
9 Neural Crest Differentiation
10 TWEAK Signaling Pathway
11 Integrated Breast Cancer Pathway
12 Signalling by NGF
13 RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
14 Mitotic G1-G1/S phases
15 Factors involved in megakaryocyte development and platelet production
16 Cell Cycle
17 Androgen receptor signaling pathway
Target-Related Models and Studies
Target Validation
Target QSAR Model
References
REF 1 Protein methyltransferases as a target class for drug discovery. Nat Rev Drug Discov. 2009 Sep;8(9):724-32.
REF 2 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
REF 3 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7006).
REF 4 Hughes B: 2009 FDA drug approvals. Nat Rev Drug Discov. 2010 Feb;9(2):89-92.
REF 5 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 6852).
REF 6 Emerging therapies for multiple myeloma. Expert Opin Emerg Drugs. 2009 Mar;14(1):99-127.
REF 7 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8305).
REF 8 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025931)
REF 9 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 10 Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
REF 11 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
REF 12 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7008).
REF 13 MGCD0103, a novel isotype-selective histone deacetylase inhibitor, has broad spectrum antitumor activity in vitro and in vivo. Mol Cancer Ther. 2008 Apr;7(4):759-68.
REF 14 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8480).
REF 15 Emerging disease-modifying therapies for the treatment of motor neuron disease/amyotropic lateral sclerosis. Expert Opin Emerg Drugs. 2007 May;12(2):229-52.
REF 16 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7502).
REF 17 2011 Pipeline of 4SC AG.
REF 18 ClinicalTrials.gov (NCT02448641) Study of Modified Stem Cells (SB623) in Patients With Chronic Motor Deficit From Ischemic Stroke. U.S. National Institutes of Health.
REF 19 The enhancement of phase 2 enzyme activities by sodium butyrate in normal intestinal epithelial cells is associated with Nrf2 and p53. Mol Cell Biochem. 2012 Nov;370(1-2):7-14.
REF 20 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8391).
REF 21 A phase I pharmacokinetic and pharmacodynamic study of CHR-3996, an oral class I selective histone deacetylase inhibitor in refractory solid tumors. Clin Cancer Res. 2012 May 1;18(9):2687-94.
REF 22 ClinicalTrials.gov (NCT02414516) A Dose-Escalation Study of OBP-801 in Patients With Advanced Solid Tumors. U.S. National Institutes of Health.
REF 23 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7501).
REF 24 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800035788)
REF 25 Epigenetics in vascular disease - therapeutic potential of new agents. Curr Vasc Pharmacol. 2014 Jan;12(1):77-86.
REF 26 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004320)
REF 27 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 8367).
REF 28 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800002525)
REF 29 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800018698)
REF 30 Preclinical and clinical studies of clindamycin-2-phosphate (author's transl). Jpn J Antibiot. 1977 Jan;30(1):42-50.
REF 31 HDAC inhibitors repress the polycomb protein BMI1. Cell Cycle. 2010 Jul 15; 9(14): 2722-2730.
REF 32 Inhibition of maize histone deacetylases by HC toxin, the host-selective toxin of Cochliobolus carbonum. Plant Cell. 1995 Nov;7(11):1941-50.
REF 33 Selective extraction of an intrinsic fat-cell plasma-membrane glycoprotein by Triton X-100. Correlation with [3H]cytochalasin B binding activity. FEBS Lett. 1977 Nov 1;83(1):71-5.
REF 34 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 7505).
REF 35 Class I histone deacetylase-selective novel synthetic inhibitors potently inhibit human tumor proliferation. Clin Cancer Res. 2004 Aug 1;10(15):5271-81.
REF 36 Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800007547)
REF 37 Emerging drugs in cutaneous T cell lymphoma. Expert Opin Emerg Drugs. 2008 Jun;13(2):345-61.
REF 38 Histone deacetylase inhibitors in cancer therapy: latest developments, trends and medicinal chemistry perspective. Anticancer Agents Med Chem. 2007 Sep;7(5):576-92.
REF 39 Anticancer activities of histone deacetylase inhibitors. Nat Rev Drug Discov. 2006 Sep;5(9):769-84.
REF 40 Discovery of a potent class I selective ketone histone deacetylase inhibitor with antitumor activity in vivo and optimized pharmacokinetic properties. J Med Chem. 2009 Jun 11;52(11):3453-6.
REF 41 Interpreting expression profiles of cancers by genome-wide survey of breadth of expression in normal tissues. Genomics 2005 Aug;86(2):127-41.
REF 42 Emerging drugs for the therapy of primary and post essential thrombocythemia, post polycythemia vera myelofibrosis. Expert Opin Emerg Drugs. 2009 Sep;14(3):471-9.
REF 43 NVP-LAQ824 is a potent novel histone deacetylase inhibitor with significant activity against multiple myeloma. Blood. 2003 Oct 1;102(7):2615-22.
REF 44 Two histone deacetylase inhibitors, trichostatin A and sodium butyrate, suppress differentiation into osteoclasts but not into macrophages. Blood. 2003 May 1;101(9):3451-9.
REF 45 URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2658).
REF 46 Novel histone deacetylase 6 (HDAC6) selective inhibitors: a patent evaluation (WO2014181137).Expert Opin Ther Pat. 2017 Mar;27(3):229-236.
REF 47 Cyclin-dependent kinase inhibitors for cancer therapy: a patent review (2009 - 2014).Expert Opin Ther Pat. 2015;25(9):953-70.
REF 48 HDAC inhibitors: a 2013-2017 patent survey.Expert Opin Ther Pat. 2018 Apr 19:1-17.
REF 49 Heterocyclic ketones as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2003 Nov 17;13(22):3909-13.
REF 50 Trifluoromethyl ketones as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2002 Dec 2;12(23):3443-7.
REF 51 New sulfurated derivatives of valproic acid with enhanced histone deacetylase inhibitory activity. Bioorg Med Chem Lett. 2008 Mar 15;18(6):1893-7.
REF 52 Design and synthesis of a novel class of histone deacetylase inhibitors. Bioorg Med Chem Lett. 2001 Nov 5;11(21):2847-50.
REF 53 Structure-based optimization of phenylbutyrate-derived histone deacetylase inhibitors. J Med Chem. 2005 Aug 25;48(17):5530-5.
REF 54 Zn2+-chelating motif-tethered short-chain fatty acids as a novel class of histone deacetylase inhibitors. J Med Chem. 2004 Jan 15;47(2):467-74.
REF 55 Histone deacetylase inhibitors. J Med Chem. 2003 Nov 20;46(24):5097-116.
REF 56 Novel inhibitors of human histone deacetylases: design, synthesis, enzyme inhibition, and cancer cell growth inhibition of SAHA-based non-hydroxama... J Med Chem. 2005 Feb 24;48(4):1019-32.
REF 57 Inhibitors of human histone deacetylase: synthesis and enzyme and cellular activity of straight chain hydroxamates. J Med Chem. 2002 Feb 14;45(4):753-7.
REF 58 Chemical phylogenetics of histone deacetylases. Nat Chem Biol. 2010 Mar;6(3):238-243.
REF 59 Design of novel histone deacetylase inhibitors. Bioorg Med Chem Lett. 2007 Aug 15;17(16):4619-24.
REF 60 Stereodefined and polyunsaturated inhibitors of histone deacetylase based on (2E,4E)-5-arylpenta-2,4-dienoic acid hydroxyamides. Bioorg Med Chem Lett. 2004 May 17;14(10):2477-81.
REF 61 Acylurea connected straight chain hydroxamates as novel histone deacetylase inhibitors: Synthesis, SAR, and in vivo antitumor activity. Bioorg Med Chem Lett. 2010 Jun 1;20(11):3314-21.
REF 62 Inhibitors selective for HDAC6 in enzymes and cells. Bioorg Med Chem Lett. 2010 Dec 1;20(23):7067-70.
REF 63 Aromatic sulfide inhibitors of histone deacetylase based on arylsulfinyl-2,4-hexadienoic acid hydroxyamides. J Med Chem. 2006 Jan 26;49(2):800-5.
REF 64 Structure-activity relationships of aryloxyalkanoic acid hydroxyamides as potent inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2007 Jan 1;17(1):136-41.
REF 65 Alpha-keto amides as inhibitors of histone deacetylase. Bioorg Med Chem Lett. 2003 Oct 6;13(19):3331-5.
REF 66 A novel series of histone deacetylase inhibitors incorporating hetero aromatic ring systems as connection units. Bioorg Med Chem Lett. 2003 Nov 3;13(21):3817-20.
REF 67 Design, synthesis, structure--selectivity relationship, and effect on human cancer cells of a novel series of histone deacetylase 6-selective inhib... J Med Chem. 2007 Nov 1;50(22):5425-38.
REF 68 3D-QSAR studies of HDACs inhibitors using pharmacophore-based alignment. Eur J Med Chem. 2009 Jul;44(7):2868-76.
REF 69 Identification and optimisation of a series of substituted 5-pyridin-2-yl-thiophene-2-hydroxamic acids as potent histone deacetylase (HDAC) inhibit... Bioorg Med Chem Lett. 2007 Jan 15;17(2):363-9.
REF 70 Non-peptide macrocyclic histone deacetylase inhibitors. J Med Chem. 2009 Jan 22;52(2):456-68.
REF 71 Evaluation of antiangiogenic activity of azumamides by the in vitro vascular organization model using mouse induced pluripotent stem (iPS) cells. Bioorg Med Chem Lett. 2008 May 1;18(9):2982-4.
REF 72 Molecular design of histone deacetylase inhibitors by aromatic ring shifting in chlamydocin framework. Bioorg Med Chem. 2007 Dec 15;15(24):7830-9.
REF 73 Three new cyclostellettamines, which inhibit histone deacetylase, from a marine sponge of the genus Xestospongia. Bioorg Med Chem Lett. 2004 May 17;14(10):2617-20.
REF 74 Gymnochromes E and F, cytotoxic phenanthroperylenequinones from a deep-water crinoid, Holopus rangii. J Nat Prod. 2010 Apr 23;73(4):712-5.
REF 75 The ChEMBL database in 2017. Nucleic Acids Res. 2017 Jan 4;45(D1):D945-D954.
REF 76 Synthesis and biological characterization of the histone deacetylase inhibitor largazole and C7- modified analogues. J Med Chem. 2010 Jun 24;53(12):4654-67.
REF 77 Biological and biophysical properties of the histone deacetylase inhibitor suberoylanilide hydroxamic acid are affected by the presence of short al... J Med Chem. 2010 Mar 11;53(5):1937-50.
REF 78 Bioorg Med Chem Lett. 2008 Dec 1;18(23):6104-9. Epub 2008 Oct 14.SAR profiles of spirocyclic nicotinamide derived selective HDAC1/HDAC2 inhibitors (SHI-1:2).
REF 79 N-(2-Amino-phenyl)-4-(heteroarylmethyl)-benzamides as new histone deacetylase inhibitors. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6729-33.
REF 80 Novel aminophenyl benzamide-type histone deacetylase inhibitors with enhanced potency and selectivity. J Med Chem. 2007 Nov 15;50(23):5543-6.
REF 81 Mercaptoamide-based non-hydroxamic acid type histone deacetylase inhibitors. Bioorg Med Chem Lett. 2005 Apr 15;15(8):1969-72.
REF 82 Design, synthesis and preliminary biological evaluation of N-hydroxy-4-(3-phenylpropanamido)benzamide (HPPB) derivatives as novel histone deacetyla... Eur J Med Chem. 2009 Nov;44(11):4470-6.
REF 83 Histone deacetylase inhibitors: from bench to clinic. J Med Chem. 2008 Mar 27;51(6):1505-29.
REF 84 Sulfamides as novel histone deacetylase inhibitors. Bioorg Med Chem Lett. 2009 Jan 15;19(2):336-40.
REF 85 Isoxazole moiety in the linker region of HDAC inhibitors adjacent to the Zn-chelating group: effects on HDAC biology and antiproliferative activity. Bioorg Med Chem Lett. 2009 Jun 1;19(11):3023-6.
REF 86 Selective histone deacetylase 6 inhibitors bearing substituted urea linkers inhibit melanoma cell growth. J Med Chem. 2012 Nov 26;55(22):9891-9.
REF 87 Histone deacetylase inhibitors through click chemistry. J Med Chem. 2008 Dec 11;51(23):7417-27.
REF 88 Structure-activity relationships on phenylalanine-containing inhibitors of histone deacetylase: in vitro enzyme inhibition, induction of differenti... J Med Chem. 2002 Jul 18;45(15):3296-309.
REF 89 On the function of the 14 A long internal cavity of histone deacetylase-like protein: implications for the design of histone deacetylase inhibitors. J Med Chem. 2004 Jun 17;47(13):3409-17.
REF 90 N-Hydroxy-(4-oxime)-cinnamide: a versatile scaffold for the synthesis of novel histone deacetylase [correction of deacetilase] (HDAC) inhibitors. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2346-9.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Wang and Dr. Li.