Target Information

Target General Information

Top

Target ID

T97111 (Former ID: TTDNC00540)

Target Name

Leukocyte antigen CD37 (CD37)

Synonyms

Tspan26; Tspan-26; Tetraspanin26; Tetraspanin-26

Click to Show/Hide

Gene Name

CD37

Target Type

Clinical trial target

[1]

Disease

[+] 5 Target-related Diseases

Diffuse large B-cell lymphoma [ICD-11: 2A81]

Malignant haematopoietic neoplasm [ICD-11: 2B33]

Mature T-cell lymphoma [ICD-11: 2A90]

Mature B-cell leukaemia [ICD-11: 2A82]

Solid tumour/cancer [ICD-11: 2A00-2F9Z]

Function

extracellular exosome, immunological synapse, integral component of plasma membrane, membrane, cell surface receptor signaling pathway.

Click to Show/Hide

BioChemical Class

Tetraspanin

UniProt ID

CD37_HUMAN

Sequence

MSAQESCLSLIKYFLFVFNLFFFVLGSLIFCFGIWILIDKTSFVSFVGLAFVPLQIWSKV
LAISGIFTMGIALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRAQLERSLR
DVVEKTIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAHRVPCS
CYNLSATNDSTILDKVILPQLSRLGHLARSRHSADICAVPAESHIYREGCAQGLQKWLHN
NLISIVGICLGVGLLELGFMTLSIFLCRNLDHVYNRLARYR

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 6 Clinical Trial Drugs

BI-836826

Drug Info

Phase 2

Diffuse large B-cell lymphoma

[2]

IMGN529

Drug Info

Phase 2

Non-hodgkin lymphoma

[3]

Naratuximab emtansine

Drug Info

Phase 2

Diffuse large B-cell lymphoma

[4]

Otlertuzumab

Drug Info

Phase 2

Chronic lymphocytic leukaemia

[2], [3], [5]

GEN3009

Drug Info

Phase 1/2

B-cell non-hodgkin lymphoma

[6]

TRU-016

Drug Info

Phase 1/2

Chronic lymphocytic leukaemia

[7]

Preclinical Drug(s)

[+] 1 Preclinical Drugs

212Pb-labelled aCD37

Drug Info

Preclinical

leukaemia

[8]

Mode of Action

[+] 2 Modes of Action

Inhibitor

[+] 2 Inhibitor drugs

Naratuximab emtansine

Drug Info

[10]

Otlertuzumab

Drug Info

[2], [3]

Modulator

[+] 1 Modulator drugs

TRU-016

Drug Info

[12]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Human Similarity Proteins Human Tissue Distribution Human Pathway Affiliation

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Human Similarity Proteins

Human Tissue Distribution

Human Pathway Affiliation

There is no similarity protein (E value < 0.005) for this target


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
Hematopoietic cell lineage	hsa04640	Affiliated Target
Class: Organismal Systems => Immune system	Pathway Hierarchy

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 1 KEGG Pathways

Hematopoietic cell lineage

References

Top

REF 1

The CD37-targeted antibody-drug conjugate IMGN529 is highly active against human CLL and in a novel CD37 transgenic murine leukemia model. Leukemia. 2014 Jul;28(7):1501-10.

REF 2

Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)

REF 3

Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)

REF 4

ClinicalTrials.gov (NCT02564744) Study to Evaluate the Efficacy and Tolerability Debio 1562 in Combination With Rituximab in Patients With Relapsed and/or Refractory DLBCL and Other Forms of NHL. U.S. National Institutes of Health.

REF 5

Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)

REF 6

ClinicalTrials.gov (NCT04358458) First-in-Human (FIH) Trial of GEN3009 in Subjects With Relapsed or Refractory B-Cell Non-Hodgkin Lymphomas. U.S. National Institutes of Health.

REF 7

ClinicalTrials.gov (NCT01188681) Safety and Efficacy Study of TRU-016 Plus Bendamustine vs. Bendamustine in Relapsed Chronic Lymphocytic Leukemia. U.S. National Institutes of Health.

REF 8

Radiopharmaceutical therapy in cancer: clinical advances and challenges. Nat Rev Drug Discov. 2020 Sep;19(9):589-608.

REF 9

Anti-CD37 antibodies for chronic lymphocytic leukemia. Expert Opin Biol Ther. 2014 May;14(5):651-61.

REF 10

Clinical pipeline report, company report or official report of Debiopharm.

REF 11

Clinical pipeline report, company report or official report of AbbVie.

REF 12

TRU-016, a humanized anti-CD37 IgG fusion protein for the potential treatment of B-cell malignancies. Curr Opin Investig Drugs. 2009 Dec;10(12):1383-90.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN