Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T92128
(Former ID: TTDI02654)
|
|||||
| Target Name |
ID1 messenger RNA (ID1 mRNA)
|
|||||
| Synonyms |
bHLHb24 (mRNA); Inhibitor of differentiation 1 (mRNA); Inhibitor of DNA binding 1 (mRNA); ID (mRNA); DNA-binding protein inhibitor ID-1 (mRNA); Class B basic helix-loop-helix protein 24 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
ID1
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR Click to Show/Hide
|
|||||
| HIT2.0 ID | T38JCD | |||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Suppression of ID1 expression in colon cancer cells increases sensitivity to 5-fluorouracil. Acta Biochim Pol. 2017;64(2):315-322. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.