Target Information

Target General Information

Target ID

T91614

Target Name

Zinc finger protein RFP (TRIM27)

Synonyms

Tripartite motif-containing protein 27; Ret finger protein; RNF76; RING-type E3 ubiquitin transferase TRIM27; RING finger protein 76

Click to Show/Hide

Gene Name

TRIM27

Target Type

Literature-reported target

[1]

Function

E3 ubiquitin-protein ligase that mediates ubiquitination of PIK3C2B and inhibits its activity; mediates the formation of 'Lys-48'-linked polyubiquitin chains; the function inhibits CD4 T-cell activation. Acts as a regulator of retrograde transport: together with MAGEL2, mediates the formation of 'Lys-63'-linked polyubiquitin chains at 'Lys-220' of WASHC1, leading to promote endosomal F-actin assembly (PubMed:23452853). Has a transcriptional repressor activity by cooperating with EPC1. Induces apoptosis by activating Jun N-terminal kinase and p38 kinase and also increases caspase-3-like activity independently of mitochondrial events. May function in male germ cell development. Has DNA-binding activity and preferentially bound to double-stranded DNA.

Click to Show/Hide

BioChemical Class

TRIM/RBCC family

UniProt ID

TRI27_HUMAN

EC Number

EC 2.3.2.27

Sequence

MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Tissue Distribution Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Tissue Distribution

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
E3 ubiquitin-protein ligase TRIM8 (TRIM8)	PF00097	23.664 (62/262)	6.76E-13
E3 ubiquitin ligase TRIM40 (TRIM40)	PF13445	25.483 (66/259)	3.46E-10
E3 ubiquitin-protein ligase TRIM32 (TRIM32)	PF01436 ; PF13445	25.882 (44/170)	7.11E-09
Cardiomyopathy-associated protein 5 (CMYA5)	PF00041	27.160 (44/162)	7.69E-07
E3 ubiquitin-protein ligase RNF170 (RNF170)	PF06803 ; PF00097	38.776 (19/49)	4.14E-05
LON peptidase N-terminal domain and RING finger protein 3 (LONRF3)	PF02190 ; PF13923 ; PF13445 More >>	38.298 (18/47)	1.23E-04
RING finger protein 112 (RNF112)	PF02263 ; PF00097	28.082 (41/146)	1.36E-04
Breast cancer type 1 susceptibility protein (BRCA1)	PF00533 ; PF12820 ; PF00097 More >>	25.974 (20/77)	2.77E-04
E3 ubiquitin-protein ligase RNF8 (RNF8)	PF00498 ; PF13920	27.160 (22/81)	6.02E-04
E3 ubiquitin-protein ligase COP1 (RFWD2)	PF00400 ; PF13923	31.081 (23/74)	1.00E-03
E3 ubiquitin-protein ligase RNF114 (RNF114)	PF05605 ; PF13445 ; PF18574 More >>	51.724 (15/29)	2.00E-03
E3 ubiquitin-protein ligase UHRF2 (UHRF2)	PF00628 ; PF02182 ; PF12148 ; PF00240 More >>	33.333 (23/69)	2.00E-03
LON peptidase N-terminal domain and RING finger protein 2 (LONRF2)	PF02190 ; PF13923	31.818 (21/66)	3.00E-03
E3 ubiquitin-protein ligase RNF183 (RNF183)	PF13639	34.615 (27/78)	3.00E-03
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

Degree	2	Degree centrality	2.15E-04	Betweenness centrality	2.02E-04
Closeness centrality	1.95E-01	Radiality	1.33E+01	Clustering coefficient	0.00E+00
Neighborhood connectivity	9.50E+00	Topological coefficient	5.00E-01	Eccentricity	13
Download	Click to Download the Full PPI Network of This Target

Target Regulators

Top

Target-interacting Proteins

Target-interacting Proteins Info

References

Top

REF 1

Expression of RET finger protein predicts chemoresistance in epithelial ovarian cancer. Cancer Med. 2012 Oct;1(2):218-29.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN