Target Information

Target General Information

Target ID

T91435

Target Name

Neurotrophic tyrosine kinase ROR2 (ROR2)

Synonyms

receptor tyrosine kinase like orphan receptor 2; neurotrophic tyrosine kinase, receptor-related 2; Tyrosine-protein kinase transmembrane receptor ROR2; NTRKR2; BDB1; BDB

Click to Show/Hide

Gene Name

ROR2

Target Type

Clinical trial target

[1]

Disease

[+] 2 Target-related Diseases

Metastatic lymph node neoplasm [ICD-11: 2D60]

Renal cell carcinoma [ICD-11: 2C90]

Function

It seems to be required for cartilage and growth plate development. Phosphorylates YWHAB, leading to induction of osteogenesis and bone formation. In contrast, has also been shown to have very little tyrosine kinase activity in vitro. May act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling. Tyrosine-protein kinase receptor which may be involved in the early formation of the chondrocytes.

Click to Show/Hide

BioChemical Class

Kinase

UniProt ID

ROR2_HUMAN

EC Number

EC 2.7.10.1

Sequence

MARGSALPRRPLLCIPAVWAAAALLLSVSRTSGEVEVLDPNDPLGPLDGQDGPIPTLKGY
FLNFLEPVNNITIVQGQTAILHCKVAGNPPPNVRWLKNDAPVVQEPRRIIIRKTEYGSRL
RIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGI
ACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCD
ARSRTPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANC
MRIGIPAERLGRYHQCYNGSGMDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGG
GHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIAC
LFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELG
EDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNVVCLL
GVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIA
AGMEYLSSHHVVHKDLATRNVLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMA
PEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAW
VYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSN
VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYVPVNGYQPVPAYGAYLPNFYPV
QIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNA
PEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 3 Clinical Trial Drugs

Ozuriftamab vedotin

Drug Info

Phase 2

Head-neck squamous cell carcinoma

[2]

CCT301-38 (targeting ROR2)

Drug Info

Phase 1/2

Renal cell carcinoma

[1]

CCT301-59 (targeting ROR2)

Drug Info

Phase 1/2

Renal cell carcinoma

[1]

Mode of Action

[+] 2 Modes of Action

Inhibitor

[+] 1 Inhibitor drugs

Ozuriftamab vedotin

Drug Info

[3]

CAR-T-Cell-Therapy

[+] 2 CAR-T-Cell-Therapy drugs

CCT301-38 (targeting ROR2)

Drug Info

[1]

CCT301-59 (targeting ROR2)

Drug Info

[1]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database. The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017). Human Similarity Proteins Human Tissue Distribution Human Pathway Affiliation Biological Network Descriptors

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Biological Network Descriptors of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.

The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information (Front Pharmacol, 9, 1245, 2018; Curr Opin Struct Biol. 44:134-142, 2017).

Human Similarity Proteins

Human Tissue Distribution

Human Pathway Affiliation

Biological Network Descriptors

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	32.776 (98/299)	2.90E-34
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	26.140 (86/329)	1.05E-19
Myosin light chain kinase 3 (MYLK3)	PF00069	27.305 (77/282)	1.48E-19
Death-associated protein kinase 3 (DAPK3)	PF00069	25.322 (59/233)	3.60E-18
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	27.459 (67/244)	2.72E-17
Cyclin-dependent kinase 1 (CDK1)	PF00069	27.444 (73/266)	1.05E-16
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	27.039 (63/233)	1.27E-16
Cyclin-dependent kinase 6 (CDK6)	PF00069	26.908 (67/249)	2.35E-16
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	26.804 (78/291)	2.84E-16
Fused homolog (STK36)	PF13646 ; PF00069	27.897 (65/233)	3.46E-16
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	25.180 (70/278)	3.73E-16
Omphalocele kinase 1 (NUAK1)	PF00069	25.532 (72/282)	1.06E-15
Death-associated protein kinase 2 (DAPK2)	PF00069	26.271 (62/236)	1.07E-15
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	25.210 (60/238)	1.40E-15
Serine/threonine-protein kinase 33 (STK33)	PF00069	24.269 (83/342)	1.83E-15
Myosin light chain kinase family member 4 (MYLK4)	PF00069	26.452 (82/310)	2.15E-15
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	28.033 (67/239)	2.43E-15
Cyclin-dependent kinase 2 (CDK2)	PF00069	25.820 (63/244)	2.84E-15
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	24.615 (64/260)	2.88E-15
Cyclin-dependent kinase 3 (CDK3)	PF00069	28.837 (62/215)	3.03E-15
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	24.096 (80/332)	4.13E-15
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	27.381 (69/252)	5.86E-15
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	26.736 (77/288)	7.01E-15
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	24.528 (65/265)	7.16E-15
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	21.805 (58/266)	7.23E-15
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	27.155 (63/232)	8.76E-15
Cyclin-dependent kinase-like 1 (CDKL1)	PF00069	26.778 (64/239)	1.17E-14
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	25.000 (65/260)	1.21E-14
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	25.306 (62/245)	1.35E-14
Cyclin-dependent kinase 15 (CDK15)	PF00069	26.877 (68/253)	1.37E-14
Cyclin-dependent kinase 17 (CDK17)	PF12330 ; PF00069	25.940 (69/266)	2.53E-14
Cyclin-dependent kinase 5 (CDK5)	PF00069	27.083 (65/240)	2.73E-14
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	26.190 (66/252)	2.78E-14
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	24.597 (61/248)	2.88E-14
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	27.778 (65/234)	5.42E-14
Aurora kinase A (AURKA)	PF00069	23.355 (71/304)	5.74E-14
Cyclin-dependent kinase 14 (CDK14)	PF00069	26.042 (75/288)	6.63E-14
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	26.481 (76/287)	8.32E-14
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	23.134 (62/268)	9.97E-14
Cyclin-dependent kinase 4 (CDK4)	PF00069	27.636 (76/275)	1.07E-13
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	25.000 (69/276)	1.33E-13
NIMA-related kinase 6 (NEK6)	PF00069	26.244 (58/221)	1.48E-13
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	25.100 (63/251)	1.49E-13
Serine/threonine-protein kinase 17B (STK17B)	PF00069	24.127 (76/315)	1.91E-13
Cyclin-dependent kinase 16 (CDK16)	PF12330 ; PF00069	25.207 (61/242)	2.12E-13
Cyclin-dependent kinase-like 4 (CDKL4)	PF00069	25.214 (59/234)	3.01E-13
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	25.670 (67/261)	5.08E-13
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	24.159 (79/327)	6.24E-13
Serine/threonine-protein kinase 10 (STK10)	PF00069 ; PF12474	28.571 (62/217)	6.32E-13
NIMA-related kinase 7 (NEK7)	PF00069	25.498 (64/251)	7.88E-13
Checkpoint kinase-1 (CHK1)	PF00069	27.982 (61/218)	8.11E-13
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	20.863 (58/278)	9.80E-13
MST-1 protein kinase (STK4)	PF11629 ; PF00069	25.630 (61/238)	1.18E-12
Serine/threonine-protein kinase 24 (STK24)	PF00069	23.420 (63/269)	1.30E-12
BR serine/threonine kinase 2 (BRSK2)	PF00069	26.432 (60/227)	2.18E-12
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	26.087 (78/299)	2.52E-12
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	28.182 (62/220)	2.60E-12
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	23.868 (58/243)	3.62E-12
Calmodulin-dependent kinase II (CAMKK2)	PF00069	30.435 (56/184)	3.63E-12
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	21.892 (81/370)	3.96E-12
Serine/threonine-protein kinase 25 (STK25)	PF00069	23.729 (70/295)	4.02E-12
BR serine/threonine kinase 1 (BRSK1)	PF00069	25.306 (62/245)	6.02E-12
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	22.709 (57/251)	6.72E-12
Serine/threonine-protein kinase ICK (CILK1)	PF00069	27.039 (63/233)	8.45E-12
Myosin light chain kinase 2 (MYLK2)	PF00069	26.482 (67/253)	8.48E-12
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	24.521 (64/261)	8.65E-12
Cyclin-dependent kinase 18 (CDK18)	PF00069	24.291 (60/247)	9.37E-12
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	24.231 (63/260)	9.89E-12
Aurora kinase C (AURKC)	PF00069	24.783 (57/230)	1.39E-11
Cytoplasmic DRAK1 (STK17A)	PF00069	26.201 (60/229)	1.74E-11
Serine/threonine-protein kinase MAK (MAK)	PF00069	27.236 (67/246)	1.88E-11
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	26.715 (74/277)	2.00E-11
Serine/threonine-protein kinase 26 (STK26)	PF00069	23.420 (63/269)	2.02E-11
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	24.375 (78/320)	2.14E-11
Salt-inducible kinase 1 (SIK1)	PF00069	24.375 (78/320)	2.20E-11
Cyclin-dependent kinase 10 (CDK10)	PF00069	27.111 (61/225)	2.36E-11
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	23.973 (70/292)	2.70E-11
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	22.000 (55/250)	4.21E-11
Cyclin-dependent kinase 7 (CDK7)	PF00069	23.853 (52/218)	4.64E-11
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	25.352 (54/213)	4.78E-11
Titin (TTN)		22.785 (54/237)	6.42E-11
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	26.545 (73/275)	7.49E-11
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	22.671 (73/322)	9.16E-11
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	25.641 (70/273)	9.52E-11
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	25.820 (63/244)	9.72E-11
TGF-beta receptor type I (TGFBR1)	PF01064 ; PF00069 ; PF08515 More >>	23.580 (83/352)	1.05E-10
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	24.561 (42/171)	1.30E-10
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	24.885 (54/217)	1.54E-10
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	23.741 (66/278)	1.55E-10
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	24.699 (41/166)	1.75E-10
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	25.424 (60/236)	1.83E-10
Salt-inducible kinase 2 (SIK2)	PF00069	25.381 (50/197)	2.09E-10
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	24.576 (58/236)	2.76E-10
SIK family kinase 3 (SIK3)	PF00069	27.632 (63/228)	3.03E-10
Serine/threonine-protein kinase TAO2 (TAOK2)	PF00069	24.074 (52/216)	3.09E-10
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	26.016 (64/246)	4.30E-10
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	24.153 (57/236)	4.39E-10
Nik-related protein kinase (NRK)	PF00780 ; PF00069	26.842 (51/190)	4.74E-10
Mitogen-activated protein kinase 15 (MAPK15)	PF00069	26.210 (65/248)	5.62E-10
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	25.882 (44/170)	6.53E-10
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	23.318 (52/223)	6.94E-10
Interleukin-1 receptor-associated kinase-like 2 (IRAK2)	PF00531 ; PF00069	24.710 (64/259)	7.11E-10
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	24.766 (53/214)	7.40E-10
Mitogen-activated protein kinase 13 (MAPK13)	PF00069	28.947 (55/190)	7.48E-10
Serine/threonine-protein kinase SBK1 (SBK1)	PF00069	25.087 (72/287)	7.52E-10
MEK kinase kinase 2 (MAP4K2)	PF00780 ; PF00069	23.276 (54/232)	8.60E-10
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	23.556 (53/225)	8.67E-10
Cyclin-dependent kinase 12 (CDK12)	PF00069	25.561 (57/223)	9.15E-10
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	24.481 (59/241)	9.74E-10
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	24.895 (59/237)	1.11E-09
NIMA-related kinase 1 (NEK1)	PF00069	21.801 (46/211)	1.31E-09
Serine/threonine-protein kinase STK11 (STK11)	PF00069	27.660 (65/235)	1.56E-09
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	22.870 (51/223)	1.62E-09
Doublecortin-like kinase 3 (DCLK3)	PF00069	25.500 (51/200)	1.64E-09
Ste-20-related kinase (STK39)	PF12202 ; PF00069	24.878 (51/205)	1.67E-09
NIMA-related kinase 2 (NEK2)	PF00069	24.561 (56/228)	2.09E-09
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	21.765 (37/170)	2.12E-09
CaM-kinase IV kinase (CAMKK1)	PF00069	26.667 (64/240)	2.43E-09
Cyclin-dependent kinase 19 (CDK19)	PF00069	26.818 (59/220)	2.75E-09
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	26.160 (62/237)	3.06E-09
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	24.057 (51/212)	3.44E-09
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	25.506 (63/247)	3.45E-09
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	22.564 (44/195)	3.47E-09
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	23.111 (52/225)	3.51E-09
MAP kinase p38 (MAPK12)	PF00069	26.244 (58/221)	3.62E-09
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	23.671 (49/207)	3.72E-09
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	27.358 (58/212)	3.72E-09
TAO kinase 1 (TAOK1)	PF00069	24.074 (52/216)	4.67E-09
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	23.293 (58/249)	4.81E-09
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	26.950 (76/282)	5.46E-09
ERK activator kinase 1 (MEK1)	PF00069	23.305 (55/236)	6.21E-09
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	21.860 (47/215)	6.79E-09
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	24.000 (60/250)	7.00E-09
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	21.549 (64/297)	7.24E-09
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	21.260 (54/254)	7.26E-09
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	23.183 (67/289)	7.72E-09
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	19.811 (42/212)	7.77E-09
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	26.400 (33/125)	9.08E-09
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	27.586 (32/116)	9.92E-09
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	31.081 (46/148)	1.03E-08
Activin receptor type IB (ACVR1B)	PF01064 ; PF00069 ; PF08515 More >>	25.506 (63/247)	1.14E-08
TAO kinase 3 (TAOK3)	PF00069	25.463 (55/216)	1.23E-08
Cyclin-dependent kinase 11B (CDK11B)	PF00069	24.779 (56/226)	1.37E-08
ERK activator kinase 2 (MEK2)	PF00069	31.933 (38/119)	1.39E-08
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	22.509 (61/271)	1.41E-08
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	22.807 (65/285)	1.66E-08
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	23.148 (50/216)	1.83E-08
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	22.944 (53/231)	1.88E-08
Microtubule-associated serine/threonine-protein kinase 2 (MAST2)	PF08926 ; PF17820 ; PF00069 More >>	23.881 (48/201)	1.88E-08
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	24.664 (55/223)	2.00E-08
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	23.358 (64/274)	2.12E-08
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	26.852 (58/216)	2.27E-08
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	30.693 (31/101)	2.63E-08
Peripheral plasma membrane protein CASK (CASK)	PF00625 ; PF02828 ; PF00595 ; PF00069 ; PF00018 More >>	24.352 (47/193)	2.86E-08
G protein-coupled receptor kinase 5 (GRK5)	PF00069 ; PF00615	27.778 (35/126)	2.97E-08
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	24.180 (59/244)	2.98E-08
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	24.186 (52/215)	3.27E-08
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	24.664 (55/223)	3.54E-08
Cyclin-dependent kinase 8 (CDK8)	PF00069	28.409 (50/176)	3.94E-08
Cyclin-dependent kinase 11A (CDK11A)	PF00069	24.779 (56/226)	4.05E-08
Serine/threonine-protein kinase WNK1 (WNK1)	PF12202 ; PF00069	25.806 (64/248)	4.46E-08
MAPK/MAK/MRK overlapping kinase (MOK)	PF00069	24.153 (57/236)	4.61E-08
Stress-activated protein kinase JNK3 (JNK3)	PF00069	25.806 (56/217)	4.81E-08
Bone morphogenetic protein receptor (BMPR2)	PF01064 ; PF00069	25.301 (63/249)	5.37E-08
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	25.943 (55/212)	5.50E-08
Serine/threonine-protein kinase tousled-like 1 (TLK1)	PF00069	24.268 (58/239)	5.60E-08
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	25.106 (59/235)	6.26E-08
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	22.545 (62/275)	6.36E-08
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	22.749 (48/211)	7.43E-08
Myosin-IIIa (MYO3A)	PF00612 ; PF00063 ; PF00069 More >>	21.973 (49/223)	8.28E-08
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	21.519 (51/237)	8.55E-08
Stress-activated protein kinase 2b (p38 beta)	PF00069	29.412 (60/204)	8.72E-08
Calcium/calmodulin-dependent protein kinase type IV (CAMK4)	PF00069	23.438 (45/192)	8.88E-08
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	23.293 (58/249)	9.31E-08
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	24.000 (66/275)	9.60E-08
Yet another novel kinase 2 (STK32B)	PF00069	22.337 (65/291)	1.03E-07
PAS domain-containing serine/threonine-protein kinase (PASK)	PF13426 ; PF00069	20.961 (48/229)	1.23E-07
Beta-adrenergic receptor kinase 1 (ADRBK1)	PF00169 ; PF00069 ; PF00615 More >>	26.857 (47/175)	1.26E-07
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	25.610 (63/246)	1.28E-07
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	22.959 (45/196)	1.35E-07
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	24.354 (66/271)	1.37E-07
Activin receptor type IIA (ACVR2A)	PF01064 ; PF00069	22.442 (68/303)	1.42E-07
Phosphorylase kinase testis gamma 2 (PHKG2)	PF00069	22.167 (45/203)	1.81E-07
Stress-activated protein kinase JNK1 (JNK1)	PF00069	23.963 (52/217)	1.81E-07
Cyclin-dependent kinase-like 5 (CDKL5)	PF00069	25.000 (63/252)	1.82E-07
Serine/threonine-protein kinase 35 (STK35)	PF00069	22.619 (38/168)	1.99E-07
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	24.476 (35/143)	2.05E-07
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	25.946 (48/185)	2.48E-07
Rhodopsin kinase GRK1 (GRK1)	PF00069 ; PF00615	34.694 (34/98)	2.83E-07
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	30.508 (36/118)	2.92E-07
Microtubule-associated serine/threonine-protein kinase 4 (MAST4)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	23.109 (55/238)	3.14E-07
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	27.459 (67/244)	3.49E-07
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	28.205 (33/117)	3.50E-07
Aurora kinase B (AURKB)	PF00069	23.308 (62/266)	3.53E-07
Microtubule-associated serine/threonine-protein kinase 3 (MAST3)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	23.077 (51/221)	3.57E-07
MAPK/ERK kinase kinase 4 (MAP3K4)	PF19431 ; PF00069	23.605 (55/233)	3.86E-07
Stress-activated protein kinase JNK2 (JNK2)	PF00069	24.457 (45/184)	4.60E-07
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	22.330 (46/206)	5.35E-07
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	20.727 (57/275)	6.63E-07
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	22.535 (48/213)	6.89E-07
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	23.333 (56/240)	7.39E-07
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	21.649 (42/194)	8.31E-07
WNK lysine-deficient protein kinase 3 (WNK3)	PF12202 ; PF00069	24.775 (55/222)	9.38E-07
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	22.593 (61/270)	9.85E-07
Testis-specific serine/threonine-protein kinase 1 (TSSK1B)	PF00069	23.032 (79/343)	1.20E-06
IL-1 receptor-associated kinase 3 (IRAK3)	PF00531 ; PF00069	20.678 (61/295)	1.21E-06
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	21.354 (41/192)	1.32E-06
Serine/threonine kinase-like domain-containing protein STKLD1 (STKLD1)	PF00069	29.204 (33/113)	1.33E-06
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	24.460 (68/278)	1.35E-06
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	20.922 (59/282)	1.58E-06
Serine/threonine-protein kinase WNK2 (WNK2)	PF12202 ; PF00069	25.676 (57/222)	1.59E-06
Serine/threonine-protein kinase NLK (NLK)	PF00069	25.688 (56/218)	2.03E-06
Stress-activated protein kinase 2a (p38 alpha)	PF00069	28.108 (52/185)	2.08E-06
Serine/threonine-protein kinase greatwall (MASTL)	PF00069	21.591 (38/176)	2.31E-06
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	23.214 (52/224)	2.49E-06
Serine/threonine-protein kinase/endoribonuclease IRE2 (ERN2)	PF00069 ; PF06479	27.982 (61/218)	2.83E-06
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	20.149 (54/268)	3.42E-06
Cyclin-dependent kinase 9 (CDK9)	PF00069	22.124 (50/226)	3.47E-06
Homeodomain interacting protein kinase 2 (HIPK2)	PF00069	26.122 (64/245)	3.71E-06
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	23.849 (57/239)	3.89E-06
Dual specificity protein kinase TTK (MPS1)	PF00069	20.803 (57/274)	4.49E-06
Testis-specific serine kinase 2 (TSSK2)	PF00069	23.013 (55/239)	5.24E-06
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	23.985 (65/271)	5.66E-06
Rhodopsin kinase GRK7 (GRK7)	PF00069 ; PF00615	25.000 (47/188)	5.95E-06
Homeodomain-interacting protein kinase 1 (HIPK1)	PF00069	30.645 (38/124)	5.98E-06
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	27.473 (50/182)	6.43E-06
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	26.804 (26/97)	6.44E-06
Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform (PHKG1)	PF00069	24.171 (51/211)	7.06E-06
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	22.321 (50/224)	8.33E-06
CaM kinase-like vesicle-associated protein (CAMKV)	PF00069	19.553 (35/179)	9.18E-06
Cyclin-dependent kinase 20 (CDK20)	PF00069	24.186 (52/215)	1.02E-05
Citron Rho-interacting kinase (CIT)	PF00780 ; PF00169 ; PF00069 More >>	29.565 (34/115)	1.02E-05
Inhibitor of nuclear factor kappa-B kinase subunit epsilon (IKBKE)	PF00069 ; PF18394 ; PF18396 More >>	26.009 (58/223)	1.07E-05
Homeodomain-interacting protein kinase 3 (HIPK3)	PF00069	30.081 (37/123)	1.23E-05
Serine/threonine-protein kinase 32C (STK32C)	PF00069	20.000 (50/250)	1.28E-05
Beta-adrenergic receptor kinase 2 (ADRBK2)	PF00169 ; PF00069 ; PF00615 More >>	24.571 (43/175)	1.57E-05
Homeodomain-interacting protein kinase 4 (HIPK4)	PF00069	26.000 (65/250)	2.22E-05
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	22.277 (45/202)	2.40E-05
MAPK-activated protein kinase 3 (MAPKAPK3)	PF00069	20.952 (44/210)	2.42E-05
PRKR-like endoplasmic reticulum kinase (PERK)	PF00069	29.907 (32/107)	2.69E-05
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	24.898 (61/245)	2.87E-05
NDR1 protein kinase (STK38)	PF00069 ; PF00433	21.893 (37/169)	4.21E-05
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	21.939 (43/196)	5.26E-05
Neuroplastin (NPTN)	PF13927	36.905 (31/84)	5.98E-05
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	22.476 (69/307)	6.61E-05
Mitogen-activated protein kinase 4 (MAPK4)	PF00069	23.923 (50/209)	1.70E-04
Cell adhesion molecule 2 (CADM2)	PF08205 ; PF13927 ; PF07686 More >>	37.975 (30/79)	1.99E-04
Serine/threonine-protein kinase ULK4 (ULK4)	PF00069	25.651 (69/269)	2.07E-04
Testis-specific serine/threonine-protein kinase 4 (TSSK4)	PF00069	24.390 (40/164)	2.14E-04
MAM domain-containing glycosylphosphatidylinositol anchor protein 1 (MDGA1)	PF13927 ; PF00629	34.286 (24/70)	2.23E-04
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	28.090 (25/89)	2.58E-04
Serine/threonine-protein kinase 32A (STK32A)	PF00069	20.513 (48/234)	3.12E-04
Sugen kinase 110 (SBK3)	PF00069	27.381 (46/168)	3.93E-04
ERK activator kinase 7 (MAP2K7)	PF00069	22.485 (38/169)	4.20E-04
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	21.053 (44/209)	4.68E-04
Serine/threonine-protein kinase pim-2 (PIM2)	PF00069	21.843 (64/293)	4.76E-04
Serine/threonine-protein kinase NIK (MAP3K14)	PF00069	22.222 (42/189)	5.03E-04
Follistatin-related protein 5 (FSTL5)	PF13927 ; PF07648	32.051 (25/78)	5.72E-04
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	22.840 (37/162)	5.86E-04
Activin receptor type IIB (ACVR2B)	PF01064 ; PF00069	23.237 (56/241)	5.95E-04
Glycogen synthase kinase-3 alpha (GSK-3A)	PF00069	25.833 (62/240)	6.87E-04
Follistatin-related protein 4 (FSTL4)	PF13927 ; PF07648	33.333 (26/78)	7.56E-04
Testis-specific serine/threonine-protein kinase 3 (TSSK3)	PF00069	23.109 (55/238)	8.13E-04
Serine/threonine-protein kinase cot (COT)	PF00069	22.174 (51/230)	1.00E-03
PDZ binding kinase (PBK)	PF00069	22.857 (56/245)	1.00E-03
Hyaluronan and proteoglycan link protein 3 (HAPLN3)	PF07686 ; PF00193	27.451 (42/153)	2.00E-03
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	32.692 (34/104)	2.00E-03
Protein turtle homolog B (IGSF9B)	PF13895 ; PF13927	33.721 (29/86)	2.00E-03
Membrane-associated kinase (PKMYT1)	PF00069	26.263 (26/99)	2.00E-03
Dual-specificity tyrosine-phosphorylation regulated kinase 3 (DYRK3)	PF00069	26.374 (24/91)	2.00E-03
Eukaryotic translation initiation factor 2-alpha kinase 4 (EIF2AK4)	PF12745 ; PF00069 ; PF05773 ; PF13393 More >>	30.172 (35/116)	3.00E-03
Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)	PF00069	30.769 (32/104)	3.00E-03
Serine/threonine-protein kinase LATS1 (LATS1)	PF00069 ; PF00627	20.364 (56/275)	4.00E-03
Cell adhesion molecule 4 (CADM4)	PF08205 ; PF13927 ; PF07686 More >>	31.707 (26/82)	4.00E-03
NDR2 protein kinase (STK38L)	PF00069 ; PF00433	20.710 (35/169)	4.00E-03
MAPK-activated protein kinase 2 (MAPKAPK2)	PF00069	24.762 (26/105)	4.00E-03
CDC42 binding protein kinase alpha (DMPK-like alpha)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 ; PF00433 More >>	21.667 (65/300)	5.00E-03
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
Wnt signaling pathway	hsa04310	Affiliated Target
Class: Environmental Information Processing => Signal transduction	Pathway Hierarchy

Degree	10	Degree centrality	1.07E-03	Betweenness centrality	7.90E-07
Closeness centrality	2.01E-01	Radiality	1.35E+01	Clustering coefficient	6.89E-01
Neighborhood connectivity	2.15E+01	Topological coefficient	2.59E-01	Eccentricity	12
Download	Click to Download the Full PPI Network of This Target

Target Affiliated Biological Pathways

Top

KEGG Pathway

[+] 1 KEGG Pathways

Wnt signaling pathway

References

Top

REF 1

ClinicalTrials.gov (NCT03393936) Safety and Efficacy of CCT301 CAR-T in Adult Subjects With Recurrent or Refractory Stage IV Renal Cell Carcinoma

REF 2

ClinicalTrials.gov (NCT05271604) A Phase 2 Open-Label Study of Ozuriftamab Vedotin (BA3021) in PD-1/L1 Failure Patients With Recurrent or Metastatic Squamous Cell Carcinoma of the Head and Neck. U.S.National Institutes of Health.

REF 3

Clinical pipeline report, company report or official report of BioAtla

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN