Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T91259
(Former ID: TTDI00146)
|
|||||
Target Name |
Retinoid-inducible nuclear factor (CXXC5)
|
|||||
Synonyms |
TCCCIA00297; Retinoidinducible nuclear factor; RINF; Putative NFkappaBactivating protein 102; Putative NF-kappa-B-activating protein 102; Putative MAPKactivating protein PM08; Putative MAPK-activating protein PM08; HSPC195; CXXCtype zinc finger protein 5; CXXC-type zinc finger protein 5; CF5
Click to Show/Hide
|
|||||
Gene Name |
CXXC5
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Acts as a mediator of BMP4-mediated modulation of canonical Wnt signaling activity in neural stem cells. Required for DNA damage-induced ATM phosphorylation, p53 activation and cell cycle arrest. Involved in myelopoiesis. Transcription factor. Binds to the oxygen responsive element of COX4I2 and represses its transcription under hypoxia conditions (4% oxygen), as well as normoxia conditions (20% oxygen). May repress COX4I2 transactivation induced by CHCHD2 and RBPJ. May indirectly participate in activation of the NF-kappa-B and MAPK pathways.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MSSLGGGSQDAGGSSSSSTNGSGGSGSSGPKAGAADKSAVVAAAAPASVADDTPPPERRN
KSGIISEPLNKSLRRSRPLSHYSSFGSSGGSGGGSMMGGESADKATAAAAAASLLANGHD LAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTEMLKRVVQEHL PLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGL AEYPMQGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELK KKPSAALEKVMLPTGAAFRWFQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
Degree | 1 | Degree centrality | 1.07E-04 | Betweenness centrality | 0.00E+00 |
---|---|---|---|---|---|
Closeness centrality | 1.97E-01 | Radiality | 1.34E+01 | Clustering coefficient | 0.00E+00 |
Neighborhood connectivity | 4.30E+01 | Topological coefficient | 1.00E+00 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | CXXC5 suppresses hepatocellular carcinoma by promoting TGF--induced cell cycle arrest and apoptosis. J Mol Cell Biol. 2018 Feb 1;10(1):48-59. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.