Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T85419
(Former ID: TTDR01428)
|
|||||
Target Name |
Influenza NA messenger RNA (Influenza NA mRNA)
|
|||||
Synonyms |
Neuraminidase (mRNA); NA of influenza (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
Influenza NA mRNA
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Influenza [ICD-11: 1E30-1E32] | |||||
Function |
Cleaves off the terminal sialic acids on the glycosylated HA during virus budding to facilitate virus release. Additionally helps virus spread through the circulation by further removing sialic acids from the cell surface. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell. Otherwise, infection would be limited to one round of replication. Described as a receptor-destroying enzyme because it cleaves a terminal sialic acid from the cellular receptors. May facilitate viral invasion of the upper airways by cleaving the sialic acid moities on the mucin of the airway epithelial cells. Likely to plays a role in the budding process through its association with lipid rafts during intracellular transport. May additionally display a raft-association independent effect on budding. Plays a role in the determination of host range restriction on replication and virulence. Sialidase activity in late endosome/lysosome traffic seems to enhance virus replication. Catalyzes the removal of terminal sialic acid residues from viral and cellular glycoconjugates.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
EC Number |
EC 3.2.1.18
|
|||||
Sequence |
MNPNQKIITIGSICMVVGIISLMLQIGNIISVWVSHIIQTWHPNQPEPCNQSINFYTEQA
AASVTLAGNSSLCPISGWAIYSKDNSIRIGSKGDVFVIREPFISCSHLECRTFFLTQGAL LNDKHSNGTVKDRSPYRTLMSCPVGEAPSPYNSRFESVAWSASACHDGISWLTIGISGPD NGAVAVLKYNGIITDTIKSWRNNILRTQESECACVNGSCFTVMTDGPSNEQASYKIFKIE KGRVVKSVELNAPNYHYEECSCYPDAGEITCVCRDNWHGSNRPWVSFNQNLEYQIGYICS GVFGDSPRPNDGTGSCGPVSLNGAYGVKGFSFKYGNGVWIGRTKSTSSRSGFEMIWDPNG WTETDSSFSLKQDIIAITDWSGYSGSFIQHPELTGLNCMRPCFWVELIRGRPKEKTIWTS GSSISFCGVNSDTVGWSWPDGADLPFTIDK Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | ALN-FLU01 | Drug Info | Preclinical | Influenza virus infection | [2] |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Respiratory viral diseases: access to RNA interference therapy. Drug Discov Today Ther Strateg. 2007; 4(4): 273-276. | |||||
REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800022658) | |||||
REF 3 | US patent application no. 5,580,767, Inhibition of influenza viruses by antisense oligonucleotides. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.