Target Information

Target General Information

Target ID

T81903 (Former ID: TTDI00105)

Target Name

Osteoclast-associated receptor (OSCAR)

Synonyms

hOSCAR; Polymeric immunoglobulin receptor 3; PolyIg receptor 3; PIgR3; Osteoclastassociated immunoglobulinlike receptor; OSCAR

Click to Show/Hide

Gene Name

OSCAR

Target Type

Literature-reported target

[1]

Function

Regulator of osteoclastogenesis which plays an importantbone-specific function in osteoclast differentiation.

Click to Show/Hide

BioChemical Class

Leukocyte receptor complex

UniProt ID

OSCAR_HUMAN

Sequence

MALVLILQLLTLWPLCHTDITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAW
RFGLFKPGEIAPLLFRDVSSELAEFFLEEVTPAQGGIYRCCYRRPDWGPGVWSQPSDVLE
LLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAAPLQYRHSAQPWA
DFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPGMQAPGPPP
SDPGAQAPSLSSFRPRGLVLQPLLPQTQDSWDPAPPPSDPGV

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function. Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006). Human Similarity Proteins Human Pathway Affiliation

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Pathway Affiliation of target is determined by the life-essential pathways provided on KEGG database. The target-affiliated pathways were defined based on the following two criteria (a) the pathways of the studied target should be life-essential for both healthy individuals and patients, and (b) the studied target should occupy an upstream position in the pathways and therefore had the ability to regulate biological function.

Targets involved in a fewer pathways have greater likelihood to be successfully developed, while those associated with more human pathways increase the chance of undesirable interferences with other human processes (Pharmacol Rev, 58: 259-279, 2006).

Human Similarity Proteins

Human Pathway Affiliation

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Killer cell immunoglobulin-like receptor 3DL3 (KIR3DL3)	PF00047	36.406 (79/217)	1.12E-23
MHC class I NK cell receptor 3DL2 (CD158k)	PF00047	34.071 (77/226)	2.97E-22
Killer cell immunoglobulin-like receptor 3DL1 (KIR3DL1)	PF00047	34.112 (73/214)	5.68E-20
Killer cell immunoglobulin-like receptor 2DL5B (KIR2DL5B)	PF00047	36.598 (71/194)	1.36E-19
Killer cell immunoglobulin-like receptor 2DL5A (KIR2DL5A)	PF00047	36.598 (71/194)	1.42E-19
Killer cell immunoglobulin-like receptor 2DL4 (KIR2DL4)	PF00047	33.971 (71/209)	1.48E-19
Killer cell immunoglobulin-like receptor 3DS1 (KIR3DS1)	PF00047	33.846 (66/195)	1.76E-18
Putative killer cell immunoglobulin-like receptor-like protein KIR3DX1 (KIR3DX1)	PF00047	31.579 (60/190)	4.35E-18
MHC class I NK cell receptor 2DL3 (CD158b2)	PF00047	32.000 (72/225)	1.31E-16
MHC class I NK cell receptor 2DL1 (CD158A)	PF00047	30.942 (69/223)	1.35E-16
MHC class I NK cell receptor 2DL2 (CD158b1)	PF00047	32.000 (72/225)	3.60E-16
Killer cell immunoglobulin-like receptor 2DS4 (KIR2DS4)	PF00047	31.390 (70/223)	3.65E-16
MHC class I NK cell receptor 2DS2 (CD158j)	PF00047	32.000 (72/225)	4.15E-16
MHC class I NK cell receptor 2DS1 (CD158h)	PF00047	30.493 (68/223)	4.44E-16
Killer cell immunoglobulin-like receptor 2DS5 (KIR2DS5)	PF00047	29.596 (66/223)	6.82E-16
Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3)	PF00047	30.222 (68/225)	2.75E-14
Natural cytotoxic triggering receptor 1 (NCR1)		29.143 (51/175)	1.10E-12
Immunoglobulin alpha Fc receptor (FCAR)		28.342 (53/187)	4.66E-11
Click to Show/Hide the Information of Human Similarity Proteins

KEGG Pathway	Pathway ID	Affiliated Target	Pathway Map
Osteoclast differentiation	hsa04380	Affiliated Target
Class: Organismal Systems => Development and regeneration	Pathway Hierarchy

References

Top

REF 1

Osteoclast-Associated Receptor (OSCAR) Distribution in the Synovial Tissues of Patients with Active RA and TNF- and RANKL Regulation of Expression... Inflammation. 2017 Oct;40(5):1566-1575.

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN