Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T81103
(Former ID: TTDI02255)
|
|||||
| Target Name |
Caspase 2 messenger RNA (CASP2 mRNA)
|
|||||
| Synonyms |
Protease ICH1 (mRNA); Protease ICH-1 (mRNA); Neural precursor cell expressed developmentally downregulated protein 2 (mRNA); Neural precursor cell expressed developmentally down-regulated protein 2 (mRNA); NEDD2 (mRNA); NEDD-2 (mRNA); ICH1 (mRNA); Caspase2 subunit p12 (mRNA); CASP-2 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
CASP2
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Optic nerve disorder [ICD-11: 9C40] | |||||
| 2 | Glaucoma [ICD-11: 9C61] | |||||
| Function |
Might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival. Associates with PIDD1 and CRADD to form the PIDDosome, a complex that activates CASP2 and triggers apoptosis in response to genotoxic stress. Involved in the activation cascade of caspases responsible for apoptosis execution.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.4.22.55
|
|||||
| Sequence |
MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHL
LEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLT TLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCT PEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELEFRSGGDVDHSTLVTLFKLLGYDV HVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVEGAIYGVDGKLLQLQEVFQLF DNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPT RSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | QPI-1007 | Drug Info | Phase 3 | Ischemic optic neuropathy | [2] | |
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| NetPath Pathway | [+] 2 NetPath Pathways | + | ||||
| 1 | TCR Signaling Pathway | |||||
| 2 | IL4 Signaling Pathway | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | HIV-1 Nef: Negative effector of Fas and TNF-alpha | |||||
| 2 | Caspase Cascade in Apoptosis | |||||
| Reactome | [+] 2 Reactome Pathways | + | ||||
| 1 | NOD1/2 Signaling Pathway | |||||
| 2 | NADE modulates death signalling | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | Apoptosis Modulation by HSP70 | |||||
| 2 | Apoptosis | |||||
| 3 | Parkinsons Disease Pathway | |||||
| 4 | Signalling by NGF | |||||
| 5 | Apoptosis Modulation and Signaling | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Toxicological and pharmacokinetic properties of QPI-1007, a chemically modified synthetic siRNA targeting caspase 2 mRNA, following intravitreal injection. Nucleic Acid Ther. 2014 Aug;24(4):258-66. | |||||
| REF 2 | Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA) | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.