Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T72319
(Former ID: TTDI00148)
|
|||||
Target Name |
Chromobox protein homolog 7 (CBX7)
|
|||||
Synonyms |
Chromobox 7
Click to Show/Hide
|
|||||
Gene Name |
CBX7
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. Promotes histone H3 trimethylation at 'Lys-9' (H3K9me3). Binds to trimethylated lysine residues in histones, and possibly also other proteins. Regulator of cellular lifespan by maintaining the repression of CDKN2A, but not by inducing telomerase activity. Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK
EERDRASGYRKRGPKPKRLLLQRLYSMDLRSSHKAKGKEKLCFSLTCPLGSGSPEGVVKA GAPELVDKGPLVPTLPFPLRKPRKAHKYLRLSRKKFPPRGPNLESHSHRRELFLQEPPAP DVLQAAGEWEPAAQPPEEEADADLAEGPPPWTPALPSSEVTVTDITANSITVTFREAQAA EGFFRDRSGKF Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | AlphaFold |
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: N-Trimethyllysine | Ligand Info | |||||
Structure Description | Chromodomain antagonists that target the polycomb-group methyllysine reader protein Chromobox homolog 7 (CBX7) | PDB:4MN3 | ||||
Method | X-ray diffraction | Resolution | 1.54 Å | Mutation | No | [2] |
PDB Sequence |
GEQVFAVESI
10 RKKRVRKGKV20 EYLVKWKGWP30 PKYSTWEPEE40 HILDPRLVMA50 YEEKEE |
|||||
|
||||||
Ligand Name: 3,6,9,12,15,18-Hexaoxaicosane-1,20-diol | Ligand Info | |||||
Structure Description | Chromodomain antagonists that target the polycomb-group methyllysine reader protein Chromobox homolog 7 (CBX7) | PDB:4MN3 | ||||
Method | X-ray diffraction | Resolution | 1.54 Å | Mutation | No | [2] |
PDB Sequence |
GEQVFAVESI
10 RKKRVRKGKV20 EYLVKWKGWP30 PKYSTWEPEE40 HILDPRLVMA50 YEEKEE |
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Tissue Distribution
of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.
The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects
(Nat Rev Drug Discov, 20: 64-81, 2021).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Human Tissue Distribution
Biological Network Descriptors
|
There is no similarity protein (E value < 0.005) for this target
|
Note:
If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.
|
Degree | 16 | Degree centrality | 1.72E-03 | Betweenness centrality | 5.41E-05 |
---|---|---|---|---|---|
Closeness centrality | 2.10E-01 | Radiality | 1.37E+01 | Clustering coefficient | 6.17E-01 |
Neighborhood connectivity | 2.63E+01 | Topological coefficient | 1.93E-01 | Eccentricity | 12 |
Download | Click to Download the Full PPI Network of This Target | ||||
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
Target Regulators | Top | |||||
---|---|---|---|---|---|---|
Target-regulating microRNAs | ||||||
Target-interacting Proteins |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | CBX7 is a glioma prognostic marker and induces G1/S arrest via the silencing of CCNE1. Oncotarget. 2017 Apr 18;8(16):26637-26647. | |||||
REF 2 | Chromodomain antagonists that target the polycomb-group methyllysine reader protein chromobox homolog 7 (CBX7). J Med Chem. 2014 Apr 10;57(7):2874-83. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.