Target Information

Target General Information

Target ID

T68525

Target Name

Inactive tyrosine-protein kinase 7 (PTK7)

Synonyms

Tyrosine-protein kinase-like 7; Pseudo tyrosine kinase receptor 7; Protein-tyrosine kinase 7; Colon carcinoma kinase 4; CCK-4

Click to Show/Hide

Gene Name

PTK7

Target Type

Clinical trial target

[1]

Disease

[+] 1 Target-related Diseases

Solid tumour/cancer [ICD-11: 2A00-2F9Z]

Function

Inactive tyrosine kinase involved in Wnt signaling pathway. Component of both the non-canonical (also known as the Wnt/planar cell polarity signaling) and the canonical Wnt signaling pathway. Functions in cell adhesion, cell migration, cell polarity, proliferation, actin cytoskeleton reorganization and apoptosis. Has a role in embryogenesis, epithelial tissue organization and angiogenesis.

Click to Show/Hide

BioChemical Class

Protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily

UniProt ID

PTK7_HUMAN

Sequence

MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGP
VHVYWLLDGAPVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSS
KERNLTLRPAGPEHSGLYSCCAHSAFGQACSSQNFTLSIADESFARVVLAPQDVVVARYE
EAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGIYR
CIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD
SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYR
CMSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSG
RYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVL
GLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATN
KRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQ
LDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ
PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEY
YHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ
AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP

Click to Show/Hide

3D Structure

Click to Show 3D Structure of This Target

AlphaFold

Drugs and Modes of Action

Top

Clinical Trial Drug(s)

[+] 1 Clinical Trial Drugs

PF-06647020

Drug Info

Phase 1

Solid tumour/cancer

[1]

Mode of Action

[+] 1 Modes of Action

Inhibitor

[+] 1 Inhibitor drugs

PF-06647020

Drug Info

[1]

Cell-based Target Expression Variations

Top

Cell-based Target Expression Variations

Cell-based Target Expression Variations Info

Different Human System Profiles of Target	Top
Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target. A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020). Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues. The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021). Human Similarity Proteins Human Tissue Distribution

Different Human System Profiles of Target

Top

Human Similarity Proteins of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.

A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs (Brief Bioinform, 21: 649-662, 2020).

Human Tissue Distribution of target is determined from a proteomics study that quantified more than 12,000 genes across 32 normal human tissues. Tissue Specificity (TS) score was used to define the enrichment of target across tissues.

The distribution of targets among different tissues or organs need to be taken into consideration when assessing the target druggability, as it is generally accepted that the wider the target distribution, the greater the concern over potential adverse effects (Nat Rev Drug Discov, 20: 64-81, 2021).

Human Similarity Proteins

Human Tissue Distribution

Protein Name	Pfam ID	Percentage of Identity (%)	E value
Titin (TTN)		24.581 (176/716)	2.84E-37
Mixed lineage kinase 1 (MAP3K9)	PF00069 ; PF14604	28.671 (82/286)	8.09E-26
NUAK family SNF1-like kinase 2 (NUAK2)	PF00069	27.817 (79/284)	1.90E-21
NIMA-related kinase 6 (NEK6)	PF00069	27.338 (76/278)	3.70E-21
NIMA-related kinase 7 (NEK7)	PF00069	29.798 (59/198)	3.28E-20
Serine/threonine-protein kinase Nek5 (NEK5)	PF00069	25.385 (66/260)	4.46E-20
Ribosomal protein S6 kinase alpha-2 (RSK2)	PF00069 ; PF00433	25.660 (68/265)	3.24E-19
Ribosomal protein S6 kinase alpha-1 (RSK1)	PF00069 ; PF00433	25.767 (84/326)	1.65E-18
Omphalocele kinase 1 (NUAK1)	PF00069	25.000 (72/288)	5.56E-18
Aurora kinase C (AURKC)	PF00069	25.517 (74/290)	6.39E-18
Ribosomal protein S6 kinase alpha-3 (RSK3)	PF00069 ; PF00433	25.758 (68/264)	1.05E-17
Aurora kinase A (AURKA)	PF00069	24.916 (74/297)	1.20E-17
Ribosomal protein S6 kinase alpha-6 (RSK6)	PF00069 ; PF00433	26.038 (69/265)	1.53E-17
Serine/threonine-protein kinase ICK (CILK1)	PF00069	29.258 (67/229)	2.31E-17
PKC-delta-interacting protein kinase (RIPK4)	PF12796 ; PF00069	27.706 (64/231)	1.79E-16
Serine/threonine-protein kinase 25 (STK25)	PF00069	23.827 (66/277)	2.84E-15
NIMA-related kinase 1 (NEK1)	PF00069	23.755 (62/261)	3.60E-15
Aurora kinase B (AURKB)	PF00069	24.013 (73/304)	3.75E-15
Serine/threonine-protein kinase MAK (MAK)	PF00069	28.319 (64/226)	4.17E-15
Serine/threonine-protein kinase 24 (STK24)	PF00069	23.611 (68/288)	4.72E-15
Cyclin-dependent kinase 6 (CDK6)	PF00069	27.391 (63/230)	4.82E-15
MAP/microtubule affinity-regulating kinase 4 (MARK4)	PF02149 ; PF00069 ; PF00627 More >>	24.046 (63/262)	6.45E-15
Serine/threonine-protein kinase MARK2 (MARK2)	PF02149 ; PF00069 ; PF00627 More >>	24.046 (63/262)	7.59E-15
Receptor-interacting serine/threonine-protein kinase 3 (RIPK3)	PF00069 ; PF12721	28.102 (77/274)	8.29E-15
Microtubule affinity regulating kinase 3 (MARK3)	PF02149 ; PF00069 ; PF00627 More >>	23.248 (73/314)	8.56E-15
Serine/threonine-protein kinase Nek3 (NEK3)	PF00069	25.758 (68/264)	1.29E-14
Tyrosine-protein kinase EIF2AK2 (p68)	PF00035 ; PF00069	22.373 (66/295)	3.15E-14
Serine/threonine-protein kinase 26 (STK26)	PF00069	22.097 (59/267)	4.17E-14
Serine/threonine-protein kinase Nek4 (NEK4)	PF00069	24.719 (66/267)	4.64E-14
Cyclin-dependent kinase 4 (CDK4)	PF00069	25.641 (60/234)	1.06E-13
Myosin-IIIa (MYO3A)	PF00612 ; PF00063 ; PF00069 More >>	23.958 (69/288)	1.08E-13
Polo-like kinase 4 (PLK4)	PF00069 ; PF18190 ; PF18409 More >>	23.077 (60/260)	1.34E-13
STE20-related serine/threonine-protein kinase (SLK)	PF00069 ; PF12474	25.177 (71/282)	1.51E-13
Microtubule-associated serine/threonine-protein kinase 3 (MAST3)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	23.077 (63/273)	1.81E-13
Protein kinase C alpha (PRKCA)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	23.856 (73/306)	2.06E-13
Cyclin-dependent kinase 2 (CDK2)	PF00069	24.664 (55/223)	2.30E-13
Serine/threonine-protein kinase MARK1 (MARK1)	PF02149 ; PF00069 ; PF00627 More >>	24.082 (59/245)	2.67E-13
MEK kinase kinase 1 (MAP4K1)	PF00780 ; PF00069	22.749 (48/211)	3.17E-13
Myosin-IIIb (MYO3B)	PF00612 ; PF00063 ; PF00069 More >>	25.225 (56/222)	3.44E-13
Serine/threonine-protein kinase ULK2 (ULK2)	PF12063 ; PF00069	22.222 (52/234)	3.48E-13
Calcium/calmodulin-dependent protein kinase type II subunit gamma (CAMK2G)	PF08332 ; PF00069	24.790 (59/238)	5.29E-13
PAK-2 protein kinase (PAK2)	PF00786 ; PF00069	22.179 (57/257)	5.72E-13
Serine/threonine-protein kinase Nek11 (NEK11)	PF00069	23.438 (60/256)	7.65E-13
Serine/threonine-protein kinase Nek8 (NEK8)	PF00069 ; PF00415	24.060 (64/266)	7.83E-13
Cyclin-dependent kinase 9 (CDK9)	PF00069	27.074 (62/229)	8.49E-13
cAMP-dependent protein kinase catalytic subunit beta (PRKACB)	PF00069	26.407 (61/231)	9.39E-13
Checkpoint kinase-1 (CHK1)	PF00069	26.718 (70/262)	1.05E-12
Calcium/calmodulin-dependent protein kinase type II subunit delta (CAMK2D)	PF08332 ; PF00069	24.812 (66/266)	1.05E-12
Serine/threonine-protein kinase ULK1 (ULK1)	PF12063 ; PF00069	25.551 (58/227)	1.06E-12
Putative serine/threonine-protein kinase PRKY (PRKY)	PF00069	21.633 (53/245)	1.53E-12
Cyclin-dependent kinase 3 (CDK3)	PF00069	24.229 (55/227)	2.19E-12
Myosin light chain kinase 3 (MYLK3)	PF00069	25.346 (55/217)	2.20E-12
Serine/threonine-protein kinase NIM1 (NIM1K)	PF00069	24.701 (62/251)	2.85E-12
5'-AMP-activated protein kinase catalytic subunit alpha-1 (PRKAA1)	PF16579 ; PF00069	23.256 (60/258)	3.54E-12
Cyclin-dependent kinase 12 (CDK12)	PF00069	25.571 (56/219)	3.61E-12
Cyclin-dependent kinase 11B (CDK11B)	PF00069	26.667 (60/225)	3.96E-12
Calmodulin-dependent kinase II (CAMKK2)	PF00069	26.147 (57/218)	4.55E-12
Calcium/calmodulin-dependent protein kinase type II subunit beta (CAMK2B)	PF08332 ; PF00069	24.893 (58/233)	4.76E-12
Cyclin-dependent kinase 1 (CDK1)	PF00069	23.214 (52/224)	4.89E-12
Protein kinase C beta (PRKCB)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	22.526 (66/293)	7.34E-12
Serine/threonine-protein kinase TAO2 (TAOK2)	PF00069	26.066 (55/211)	8.56E-12
Maternal embryonic leucine zipper kinase (MELK)	PF02149 ; PF00069	25.095 (66/263)	9.20E-12
Ribosomal protein S6 kinase beta-1 (S6K1)	PF00069 ; PF00433	21.147 (59/279)	1.12E-11
Serine/threonine-protein kinase Nek9 (NEK9)	PF00069 ; PF00415	22.519 (59/262)	1.28E-11
cAMP-dependent protein kinase catalytic subunit alpha (PRKACA)	PF00069	25.210 (60/238)	1.39E-11
CaM-kinase IV kinase (CAMKK1)	PF00069	30.337 (54/178)	1.45E-11
Cyclin-dependent kinase 11A (CDK11A)	PF00069	26.222 (59/225)	1.53E-11
Serine/threonine-protein kinase PAK 5 (PAK5)	PF00786 ; PF00069	22.581 (49/217)	1.57E-11
Cyclin-dependent kinase-like 2 (CDKL2)	PF00069	27.064 (59/218)	1.64E-11
Myosin light chain kinase 2 (MYLK2)	PF00069	28.205 (66/234)	1.67E-11
MEK kinase kinase 2 (MAP4K2)	PF00780 ; PF00069	22.749 (48/211)	1.90E-11
Myosin light chain kinase family member 4 (MYLK4)	PF00069	24.675 (57/231)	2.25E-11
Polo-like kinase 2 (PLK2)	PF00069 ; PF00659	21.401 (55/257)	2.29E-11
Cyclin-dependent kinase-like 1 (CDKL1)	PF00069	26.667 (56/210)	2.44E-11
Serine/threonine-protein kinase 10 (STK10)	PF00069 ; PF12474	24.074 (52/216)	3.51E-11
cAMP-dependent protein kinase catalytic subunit PRKX (PRKX)	PF00069	22.222 (54/243)	4.06E-11
Protein kinase C theta (PRKCQ)	PF00130 ; PF00069 ; PF00433 More >>	23.348 (53/227)	4.66E-11
Protein kinase N2 (PKN2)	PF02185 ; PF00069 ; PF00433 More >>	24.632 (67/272)	5.00E-11
Extracellular signal-regulated kinase 5 (ERK5)	PF00069	23.392 (40/171)	5.23E-11
SPS1/STE20-related protein kinase YSK4 (YSK4)	PF00069	22.222 (60/270)	5.27E-11
Cyclin-dependent kinase 13 (CDK13)	PF12330 ; PF00069	23.963 (52/217)	6.55E-11
Serine/threonine-protein kinase 33 (STK33)	PF00069	24.138 (56/232)	6.61E-11
Cyclin-dependent kinase 18 (CDK18)	PF00069	23.673 (58/245)	6.84E-11
Microtubule-associated serine/threonine-protein kinase 4 (MAST4)	PF08926 ; PF17820 ; PF02163 ; PF00069 More >>	22.266 (57/256)	6.92E-11
Ribosomal protein S6 kinase beta-2 (RPS6KB2)	PF00069 ; PF00433	22.414 (52/232)	7.04E-11
Putative serine/threonine-protein kinase SIK1B (SIK1B)	PF00069	21.923 (57/260)	7.98E-11
5'-AMP-activated protein kinase catalytic subunit alpha-2 (PRKAA2)	PF16579 ; PF00069	21.374 (56/262)	8.01E-11
PAK-4 protein kinase (PAK4)	PF00786 ; PF00069	22.222 (48/216)	8.36E-11
Fused homolog (STK36)	PF13646 ; PF00069	23.881 (48/201)	8.45E-11
Salt-inducible kinase 1 (SIK1)	PF00069	21.723 (58/267)	9.23E-11
Cyclin-dependent kinase 16 (CDK16)	PF12330 ; PF00069	25.000 (54/216)	9.79E-11
Calcium/calmodulin-dependent protein kinase type II subunit alpha (CAMK2A)	PF08332 ; PF00069	23.684 (63/266)	9.87E-11
Unc-51 like kinase 3 (ULK3)	PF04212 ; PF00069	23.077 (60/260)	1.04E-10
NIMA-related kinase 2 (NEK2)	PF00069	25.571 (56/219)	1.12E-10
Serine/threonine-protein kinase PLK3 (PLK3)	PF00069 ; PF00659	23.047 (59/256)	1.16E-10
PAK-1 protein kinase (PAK1)	PF00786 ; PF00069	20.599 (55/267)	1.23E-10
MAPK/ERK kinase kinase 1 (MAP3K1)	PF00069	22.556 (60/266)	1.26E-10
Microtubule-associated serine/threonine-protein kinase 2 (MAST2)	PF08926 ; PF17820 ; PF00069 More >>	21.771 (59/271)	1.27E-10
Protein kinase C epsilon (PRKCE)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	26.906 (60/223)	1.27E-10
Protein kinase G2 (PRKG2)	PF00027 ; PF00069	24.335 (64/263)	1.30E-10
cAMP-dependent protein kinase catalytic subunit gamma (PRKACG)	PF00069	22.509 (61/271)	1.51E-10
Cyclin-dependent kinase 17 (CDK17)	PF12330 ; PF00069	22.566 (51/226)	1.64E-10
Microtubule-associated serine/threonine-protein kinase 1 (MAST1)	PF08926 ; PF17820 ; PF00069 More >>	22.785 (54/237)	1.67E-10
TAO kinase 1 (TAOK1)	PF00069	25.118 (53/211)	1.68E-10
MST-1 protein kinase (STK4)	PF11629 ; PF00069	20.290 (56/276)	1.74E-10
Serine/threonine-protein kinase D2 (PRKD2)	PF00130 ; PF00069	25.114 (55/219)	1.78E-10
Nik-related protein kinase (NRK)	PF00780 ; PF00069	23.894 (54/226)	2.27E-10
Serine/threonine-protein kinase PAK 6 (PAK6)	PF00786 ; PF00069	21.691 (59/272)	2.52E-10
Hormonally up-regulated neu tumor-associated kinase (HUNK)	PF00069	25.714 (54/210)	2.88E-10
Polo-like kinase 1 (PLK1)	PF00069 ; PF00659	24.031 (62/258)	2.90E-10
Cyclin-dependent kinase-like 4 (CDKL4)	PF00069	24.609 (63/256)	2.96E-10
Calcium/calmodulin-dependent protein kinase type 1G (CAMK1G)	PF00069	22.500 (54/240)	3.20E-10
Ribosomal protein S6 kinase alpha-5 (RSK5)	PF00069 ; PF00433	23.443 (64/273)	4.26E-10
MAPK/MAK/MRK overlapping kinase (MOK)	PF00069	24.638 (51/207)	4.76E-10
Serine/threonine-protein kinase 3 (STK3)	PF11629 ; PF00069	20.137 (59/293)	5.10E-10
Leucine-rich repeat serine/threonine-protein kinase 1 (LRRK1)	PF12796 ; PF16095 ; PF00069 ; PF08477 More >>	24.390 (60/246)	5.25E-10
SIK family kinase 3 (SIK3)	PF00069	25.185 (68/270)	8.26E-10
Cyclin-dependent kinase-like 3 (CDKL3)	PF00069	22.275 (47/211)	1.05E-09
Serine/threonine-protein kinase 32C (STK32C)	PF00069	22.414 (52/232)	1.11E-09
Protein kinase N1 (PKN1)	PF02185 ; PF00069 ; PF00433 More >>	25.670 (67/261)	1.34E-09
Serine/threonine-protein kinase Chk2 (RAD53)	PF00498 ; PF00069	25.238 (53/210)	1.48E-09
Salt-inducible kinase 2 (SIK2)	PF00069	22.642 (60/265)	1.48E-09
Mitogen-activated protein kinase kinase kinase kinase 5 (MAP4K5)	PF00780 ; PF00069	22.642 (48/212)	1.49E-09
Extracellular signal-regulated kinase 1 (ERK1)	PF00069	24.859 (44/177)	1.50E-09
Serine/threonine-protein kinase PAK 3 (PAK3)	PF00786 ; PF00069	20.225 (54/267)	1.57E-09
Serine/threonine-protein kinase tousled-like 1 (TLK1)	PF00069	25.214 (59/234)	1.73E-09
Protein kinase G1 (PRKG1)	PF00027 ; PF16808 ; PF00069 More >>	25.346 (55/217)	1.95E-09
SNF-related serine/threonine-protein kinase (SNRK)	PF00069	24.521 (64/261)	2.00E-09
Serine/threonine-protein kinase SBK1 (SBK1)	PF00069	25.448 (71/279)	2.10E-09
Inhibitor of nuclear factor kappa-B kinase alpha (IKKA)	PF18397 ; PF12179 ; PF00069 More >>	26.415 (56/212)	2.13E-09
Protein kinase N3 (PKN3)	PF02185 ; PF00069 ; PF00433 More >>	26.484 (58/219)	2.26E-09
Protein kinase C gamma (PRKCG)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	23.750 (57/240)	2.42E-09
IL-1 receptor-associated kinase 3 (IRAK3)	PF00531 ; PF00069	24.561 (70/285)	2.59E-09
RAC-gamma serine/threonine-protein kinase (AKT3)	PF00169 ; PF00069 ; PF00433 More >>	20.202 (60/297)	2.71E-09
Cyclin-dependent kinase-like 5 (CDKL5)	PF00069	22.747 (53/233)	3.00E-09
Serine/threonine-protein kinase Nek10 (NEK10)	PF00069	24.766 (53/214)	3.14E-09
MAPK/ERK kinase kinase 3 (MAP3K3)	PF00564 ; PF00069	25.000 (51/204)	3.23E-09
Serine/threonine-protein kinase tousled-like 2 (TLK2)	PF00069	25.641 (60/234)	3.41E-09
TRAF2 and NCK interacting kinase (TNIK)	PF00780 ; PF00069	21.719 (48/221)	3.72E-09
Protein kinase D (PRKD1)	PF00130 ; PF00169 ; PF00069 More >>	26.027 (57/219)	3.81E-09
Serine/threonine-protein kinase Sgk2 (SGK2)	PF00069 ; PF00433	22.707 (52/229)	4.32E-09
Dual-specificity tyrosine-phosphorylation regulated kinase 3 (DYRK3)	PF00069	22.747 (53/233)	4.44E-09
Apoptosis signal-regulating kinase 2 (MAP3K6)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	23.247 (63/271)	4.66E-09
TAO kinase 3 (TAOK3)	PF00069	23.792 (64/269)	4.76E-09
Stress-activated protein kinase JNK1 (JNK1)	PF00069	25.000 (50/200)	4.77E-09
Cyclin-dependent kinase 5 (CDK5)	PF00069	24.324 (54/222)	4.91E-09
NDR2 protein kinase (STK38L)	PF00069 ; PF00433	19.502 (47/241)	5.44E-09
Stress-activated protein kinase JNK3 (JNK3)	PF00069	25.000 (50/200)	6.47E-09
Putative 3-phosphoinositide-dependent protein kinase 2 (PDPK2P)	PF00069	22.111 (44/199)	6.62E-09
Serine/threonine-protein kinase greatwall (MASTL)	PF00069	26.087 (42/161)	7.80E-09
Doublecortin-like kinase 1 (DCLK1)	PF03607 ; PF00069	24.681 (58/235)	1.04E-08
Testis-specific serine kinase 2 (TSSK2)	PF00069	20.000 (50/250)	1.08E-08
Cyclin-dependent kinase 10 (CDK10)	PF00069	25.472 (54/212)	1.12E-08
Testis-specific serine/threonine-protein kinase 6 (TSSK6)	PF00069	24.638 (68/276)	1.14E-08
Apoptosis signal-regulating kinase 1 (MAP3K5)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	26.923 (56/208)	1.20E-08
MAPK/ERK kinase kinase 4 (MAP3K4)	PF19431 ; PF00069	20.992 (55/262)	1.31E-08
Serine/threonine-protein kinase D3 (PRKD3)	PF00130 ; PF00169 ; PF00069 More >>	23.611 (51/216)	1.41E-08
Protein kinase C eta type (PRKCH)	PF00130 ; PF00168 ; PF00069 ; PF00433 More >>	22.566 (51/226)	1.43E-08
Phosphoinositide dependent protein kinase-1 (PDPK1)	PF14593 ; PF00069	23.500 (47/200)	1.56E-08
Proto-oncogene serine/threonine-protein kinase mos (MOS)	PF00069	23.077 (63/273)	1.77E-08
Serine/threonine-protein kinase STK11 (STK11)	PF00069	23.767 (53/223)	1.86E-08
Mitogen-activated protein kinase kinase kinase 15 (MAP3K15)	PF19039 ; PF20309 ; PF20302 ; PF13281 ; PF00069 More >>	24.335 (64/263)	1.91E-08
V-set and immunoglobulin domain-containing protein 10-like (VSIG10L)	PF13895	23.810 (60/252)	1.98E-08
Homeodomain-interacting protein kinase 4 (HIPK4)	PF00069	24.000 (54/225)	2.18E-08
Serine/threonine-protein kinase Sgk1 (SGK1)	PF00069 ; PF00433	22.170 (47/212)	2.50E-08
Fc receptor-like protein 5 (FCRL5)	PF13895	21.835 (138/632)	2.70E-08
Ribosomal protein S6 kinase alpha-4 (RPS6KA4)	PF00069 ; PF00433	22.814 (60/263)	3.40E-08
Protein kinase C iota (PRKCI)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	21.368 (50/234)	3.42E-08
BR serine/threonine kinase 2 (BRSK2)	PF00069	21.721 (53/244)	3.69E-08
Cyclin-dependent kinase 20 (CDK20)	PF00069	25.123 (51/203)	4.57E-08
TGF-beta-stimulated factor 1 (STK16)	PF00069	25.704 (73/284)	5.45E-08
Cyclin-dependent kinase 7 (CDK7)	PF00069	24.402 (51/209)	5.45E-08
Serine/threonine-protein kinase 35 (STK35)	PF00069	25.123 (51/203)	5.46E-08
Misshapen-like kinase 1 (MINK1)	PF00780 ; PF00069	20.000 (44/220)	5.76E-08
Calcium/calmodulin-dependent protein kinase type 1D (CAMK1D)	PF00069	24.051 (57/237)	5.80E-08
Stress-activated protein kinase JNK2 (JNK2)	PF00069	24.224 (39/161)	6.02E-08
MAPK/ERK kinase kinase 2 (MAP3K2)	PF00564 ; PF00069	23.786 (49/206)	6.10E-08
RAC-alpha serine/threonine-protein kinase (AKT1)	PF00169 ; PF00069 ; PF00433 More >>	22.981 (74/322)	6.28E-08
Extracellular signal-regulated kinase 2 (ERK2)	PF00069	23.729 (42/177)	6.74E-08
Large tumor suppressor homolog 2 (LATS2)	PF00069 ; PF00433	21.318 (55/258)	7.65E-08
Protein kinase C delta (PRKCD)	PF00130 ; PF00069 ; PF00433 More >>	20.614 (47/228)	7.78E-08
TBC domain-containing protein kinase-like protein (TBCK)	PF00069 ; PF00566 ; PF00581 More >>	19.665 (47/239)	7.79E-08
Serine/threonine-protein kinase pim-2 (PIM2)	PF00069	24.242 (64/264)	7.96E-08
Death-associated protein kinase 2 (DAPK2)	PF00069	21.395 (46/215)	8.74E-08
BR serine/threonine kinase 1 (BRSK1)	PF00069	21.154 (55/260)	9.24E-08
Serine/threonine-protein kinase NLK (NLK)	PF00069	27.215 (43/158)	9.87E-08
Testis-specific serine/threonine-protein kinase 1 (TSSK1B)	PF00069	20.678 (61/295)	1.05E-07
Oxidative stress responsive 1 (OXSR1)	PF12202 ; PF00069	21.371 (53/248)	1.15E-07
NDR1 protein kinase (STK38)	PF00069 ; PF00433	19.118 (52/272)	1.24E-07
MEK kinase kinase 3 (MAP4K3)	PF00780 ; PF00069	20.755 (44/212)	1.29E-07
Membrane-associated kinase (PKMYT1)	PF00069	26.106 (59/226)	1.34E-07
Cyclin-dependent kinase 14 (CDK14)	PF00069	24.645 (52/211)	1.42E-07
WNK lysine-deficient protein kinase 3 (WNK3)	PF12202 ; PF00069	27.273 (60/220)	1.74E-07
NF-kappa-B-activating kinase (TBK1)	PF00069 ; PF18394 ; PF18396 More >>	24.873 (49/197)	1.76E-07
G protein-coupled receptor kinase 5 (GRK5)	PF00069 ; PF00615	23.673 (58/245)	1.99E-07
RAC-beta serine/threonine-protein kinase (AKT2)	PF00169 ; PF00069 ; PF00433 More >>	19.913 (46/231)	2.18E-07
Serine/threonine-protein kinase H1 (PSKH1)	PF00069	20.192 (42/208)	2.20E-07
Calcium/calmodulin-dependent protein kinase type 1B (PNCK)	PF00069	24.675 (57/231)	2.21E-07
Death-associated protein kinase 1 (DAPK1)	PF00023 ; PF12796 ; PF13637 ; PF00531 ; PF00069 More >>	21.053 (48/228)	2.52E-07
Dual specificity mitogen-activated protein kinase kinase 6 (MAP2K6)	PF00069	26.794 (56/209)	2.82E-07
Serine/threonine-protein kinase WNK1 (WNK1)	PF12202 ; PF00069	27.602 (61/221)	2.82E-07
Doublecortin-like kinase 2 (DCLK2)	PF03607 ; PF00069	24.211 (46/190)	3.00E-07
Cyclin-dependent kinase 15 (CDK15)	PF00069	22.897 (49/214)	3.03E-07
G protein-coupled receptor kinase 6 (GRK6)	PF00069 ; PF00615	24.651 (53/215)	3.16E-07
Leucine-rich repeat kinase 2 (LRRK2)	PF16095 ; PF12799 ; PF13855 ; PF00069 ; PF08477 More >>	23.051 (68/295)	3.16E-07
Serine/threonine-protein kinase H2 (PSKH2)	PF00069	17.937 (40/223)	3.16E-07
G protein-coupled receptor kinase 4 (GRK4)	PF00069 ; PF00615	23.016 (58/252)	3.20E-07
Endoplasmic reticulum to nucleus signaling 1 (ERN1)	PF00069 ; PF06479	23.982 (53/221)	3.42E-07
ERK activator kinase 1 (MEK1)	PF00069	26.115 (41/157)	3.54E-07
Cyclin-G-associated kinase (GAK)	PF00069 ; PF10409	22.340 (63/282)	4.16E-07
ERK activator kinase 2 (MEK2)	PF00069	24.841 (39/157)	4.33E-07
Serine/threonine-protein kinase Sgk3 (SGK3)	PF00069 ; PF00433 ; PF00787 More >>	23.478 (54/230)	4.85E-07
Serine/threonine-protein kinase WNK2 (WNK2)	PF12202 ; PF00069	26.291 (56/213)	5.43E-07
Stress-activated protein kinase 2b (p38 beta)	PF00069	23.125 (74/320)	5.60E-07
Serine/threonine-protein kinase LATS1 (LATS1)	PF00069 ; PF00627	21.012 (54/257)	5.76E-07
Doublecortin-like kinase 3 (DCLK3)	PF00069	22.886 (46/201)	6.02E-07
Serine/threonine-protein kinase PDIK1L (PDIK1L)	PF00069	22.467 (51/227)	6.73E-07
Ste-20-related kinase (STK39)	PF12202 ; PF00069	21.774 (54/248)	7.73E-07
Mitogen-activated protein kinase 15 (MAPK15)	PF00069	24.757 (51/206)	9.49E-07
Serine/threonine-protein kinase cot (COT)	PF00069	24.876 (50/201)	1.07E-06
Cytoplasmic DRAK1 (STK17A)	PF00069	25.455 (42/165)	1.21E-06
Calcium/calmodulin-dependent protein kinase type 1 (CAMK1)	PF00069	23.500 (47/200)	1.23E-06
ERK activator kinase 5 (MAP2K5)	PF00564 ; PF00069	23.396 (62/265)	1.32E-06
MAP kinase p38 (MAPK12)	PF00069	24.862 (45/181)	1.42E-06
Serine/threonine-protein kinase pim-1 (PIM1)	PF00069	24.155 (50/207)	1.64E-06
Yet another novel kinase 2 (STK32B)	PF00069	22.381 (47/210)	1.74E-06
Death-associated protein kinase 3 (DAPK3)	PF00069	19.556 (44/225)	1.82E-06
Dual-specificity tyrosine-phosphorylation regulated kinase 2 (DYRK2)	PF00069	21.569 (44/204)	1.84E-06
Stress-activated protein kinase 2a (p38 alpha)	PF00069	23.270 (37/159)	2.77E-06
Testis-specific serine/threonine-protein kinase 4 (TSSK4)	PF00069	20.188 (43/213)	2.85E-06
Mitogen-activated protein kinase 4 (MAPK4)	PF00069	24.747 (49/198)	2.91E-06
Amphoterin-induced protein 2 (AMIGO2)	PF00047 ; PF13855	27.632 (42/152)	3.75E-06
Glycogen synthase kinase-3 alpha (GSK-3A)	PF00069	24.164 (65/269)	4.74E-06
IL-1 receptor-associated kinase 1 (IRAK1)	PF00531 ; PF00069	21.983 (51/232)	4.77E-06
Interleukin-1 receptor-associated kinase-like 2 (IRAK2)	PF00531 ; PF00069	22.086 (36/163)	4.85E-06
Peripheral plasma membrane protein CASK (CASK)	PF00625 ; PF02828 ; PF00595 ; PF00069 ; PF00018 More >>	21.073 (55/261)	6.00E-06
Pregnancy-specific beta-1-glycoprotein 5 (PSG5)	PF13895 ; PF07686	26.842 (51/190)	6.43E-06
Dual specificity mitogen-activated protein kinase kinase 3 (MAP2K3)	PF00069	23.445 (49/209)	7.33E-06
Mitogen-activated protein kinase 13 (MAPK13)	PF00069	24.255 (57/235)	7.49E-06
Rhodopsin kinase GRK1 (GRK1)	PF00069 ; PF00615	29.545 (26/88)	7.97E-06
Serine/threonine-protein kinase 17B (STK17B)	PF00069	22.222 (36/162)	7.98E-06
Carcinoembryonic antigen-related cell adhesion molecule 16 (CEACAM16)	PF13895 ; PF07686	27.237 (70/257)	9.48E-06
Fc receptor-like protein 3 (FCRL3)	PF00047 ; PF13895	24.820 (69/278)	9.79E-06
Pregnancy-specific beta-1-glycoprotein 7 (PSG7)	PF13895 ; PF07686	24.138 (42/174)	1.04E-05
Inhibitor of nuclear factor kappa-B kinase subunit epsilon (IKBKE)	PF00069 ; PF18394 ; PF18396 More >>	25.000 (44/176)	1.34E-05
Mitogen-activated protein kinase 6 (MAPK6)	PF00069	23.590 (46/195)	1.43E-05
CDC42 binding protein kinase alpha (DMPK-like alpha)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 ; PF00433 More >>	19.522 (49/251)	1.44E-05
Ribosomal protein S6 kinase-related protein (RSKR)	PF00069	24.828 (36/145)	1.48E-05
Inhibitor of nuclear factor kappa-B kinase beta (IKKB)	PF18397 ; PF12179 ; PF00069 More >>	24.096 (40/166)	1.53E-05
Serine/threonine-protein kinase 40 (STK40)	PF00069	21.557 (36/167)	1.63E-05
ERK activator kinase 7 (MAP2K7)	PF00069	26.087 (36/138)	1.79E-05
Serine/threonine-protein kinase MRCK beta (CDC42BPB)	PF00130 ; PF00780 ; PF08826 ; PF15796 ; PF00069 More >>	20.968 (52/248)	1.87E-05
Homeodomain interacting protein kinase 2 (HIPK2)	PF00069	25.561 (57/223)	2.17E-05
Homeodomain-interacting protein kinase 3 (HIPK3)	PF00069	25.346 (55/217)	2.93E-05
TGF-beta receptor type I (TGFBR1)	PF01064 ; PF00069 ; PF08515 More >>	22.830 (71/311)	3.76E-05
Serine/threonine-protein kinase 32A (STK32A)	PF00069	19.712 (41/208)	3.87E-05
Testis-specific serine/threonine-protein kinase 3 (TSSK3)	PF00069	22.727 (60/264)	4.13E-05
Protein kinase C zeta (PRKCZ)	PF00130 ; PF00564 ; PF00069 ; PF00433 More >>	20.588 (42/204)	5.09E-05
PDZ binding kinase (PBK)	PF00069	24.481 (59/241)	5.78E-05
MEK kinase kinase 4 (MAP4K4)	PF00780 ; PF00069	19.545 (43/220)	5.98E-05
Serine/threonine-protein kinase WNK4 (WNK4)	PF12202 ; PF00069	27.322 (50/183)	6.29E-05
Dual specificity mitogen-activated protein kinase kinase 4 (MAP2K4)	PF00069	23.348 (53/227)	6.96E-05
Eukaryotic translation initiation factor 2-alpha kinase 1 (EIF2AK1)	PF00069	26.000 (39/150)	8.72E-05
Click to Show/Hide the Information of Human Similarity Proteins


Note: If a protein has TS (tissue specficity) scores at least in one tissue >= 2.5, this protein is called tissue-enriched (including tissue-enriched-but-not-specific and tissue-specific). In the plots, the vertical lines are at thresholds 2.5 and 4.

References

Top

REF 1

Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)

If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.

Prof. Feng ZHU

Prof. Yuzong CHEN