Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T64987
(Former ID: TTDR00919)
|
|||||
| Target Name |
Epstein-Barr virus Latent membrane protein 1 (EBV LMP1)
|
|||||
| Synonyms |
Protein p63; P63; Latent membrane protein 1; LMP1; LMP-1; BNLF1
Click to Show/Hide
|
|||||
| Gene Name |
EBV LMP1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 2 Target-related Diseases | + | ||||
| 1 | Nasopharyngeal cancer [ICD-11: 2B6B] | |||||
| 2 | Lymphoma [ICD-11: 2A80-2A86] | |||||
| Function |
Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MERDLERGPPGPPRPPLGPPLSSSIGLALLLLLLALLFWLYIVLSNWTGGALLVLYSFAL
MLIIIILIIFIFRRDLLCPLGGLGLLLLMVTLLLIALWNLHGQALYLGIVLFIFGCLLVL GLWIYFLEILWRLGATIWQLLAFILAFFLAIILLIIALYLQQNWWTLLVDLLWLLLFMAI LIWMYFHGPRHTDEHHHDDSLPHPQQATDDSSHESDSNSNEGRHHLLVSGAGDGPPLCSQ NLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGNTDDNGPQDPDNTDDNGPHDPLPHNP SDSAGNDGGPPNLTEEVENKGGDRGPPSMTDGGGGDPHLPTLLLGTSGSGGDDDDPHGPV QLSYYD Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | LMP1-CAR-T cells | Drug Info | Phase 1/2 | Nasopharyngeal carcinoma | [1] | |
| 2 | LMP-1/LMP-2 CTLs | Drug Info | Phase 1 | Lymphoma | [2] | |
| Mode of Action | [+] 2 Modes of Action | + | ||||
| CAR-T-Cell-Therapy | [+] 1 CAR-T-Cell-Therapy drugs | + | ||||
| 1 | LMP1-CAR-T cells | Drug Info | [1] | |||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | LMP-1/LMP-2 CTLs | Drug Info | [3] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
| Protein Name | Pfam ID | Percentage of Identity (%) | E value |
|---|---|---|---|
| Dentin sialophosphoprotein (DSPP) | 26.271 (31/118) | 3.00E-03 | |
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | ClinicalTrials.gov (NCT02980315) A New EBV Related Technologies of T Cells in Treating Malignant Tumors and Clinical Application | |||||
| REF 2 | ClinicalTrials.gov (NCT00062868) LMP-specific T-cells for Patients With Relapsed EBV-positive Lymphoma. U.S. National Institutes of Health. | |||||
| REF 3 | In vivo expansion of LMP 1- and 2-specific T-cells in a patient who received donor-derived EBV-specific T-cells after allogeneic stem cell transplantation. Leuk Lymphoma. 2006 May;47(5):837-42. | |||||
| REF 4 | CA patent application no. 876139, Nanotherapeutics for drug targeting. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.