Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T63236
|
|||||
| Target Name |
C-C motif chemokine 17 (CCL17)
|
|||||
| Synonyms |
CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine
Click to Show/Hide
|
|||||
| Gene Name |
CCL17
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Chronic pain [ICD-11: MG30] | |||||
| Function |
Chemokine, which displays chemotactic activity for T lymphocytes, preferentially Th2 cells, but not monocytes or granulocytes. Therefore plays an important role in a wide range of inflammatory and immunological processes (PubMed:8702936, PubMed:9169480). Acts by binding to CCR4 at T-cell surface (PubMed:9169480, PubMed:10540332). Mediates GM-CSF/CSF2-driven pain and inflammation (PubMed:27525438). In the brain, required to maintain the typical, highly branched morphology of hippocampal microglia under homeostatic conditions. May be important for the appropriate adaptation of microglial morphology and synaptic plasticity to acute lipopolysaccharide (LPS)-induced neuroinflammation (By similarity). Plays a role in wound healing, mainly by inducing fibroblast migration into the wound (By similarity). {ECO:0000250|UniProtKB:Q9WUZ6, ECO:0000269|PubMed:10540332, ECO:0000269|PubMed:27525438, ECO:0000269|PubMed:8702936, ECO:0000269|PubMed:9169480}.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | GSK3858279 | Drug Info | Phase 2 | Osteoarthritis pain | [2] | |
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Therapeutic options for targeting inflammatory osteoarthritis pain. Nat Rev Rheumatol. 2019 Jun;15(6):355-363. | |||||
| REF 2 | ClinicalTrials.gov (NCT05838755) A Multicenter Randomized, Double-blind, Placebo-controlled Phase 2 Study to Evaluate Efficacy, Safety, Tolerability, Pharmacokinetics, and Target Engagement of GSK3858279 in Adult Participants With Chronic Diabetic Peripheral Neuropathic Pain (DPNP) /NEPTUNE-17. U.S.National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.