Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T63221
|
|||||
| Target Name |
Killer cell lectin-like receptor subfamily G member 1 (KLRG1)
|
|||||
| Synonyms |
C-type lectin domain family 15 member A; ITIM-containing receptor MAFA-L; MAFA-like receptor; Mast cell function-associated antigen
Click to Show/Hide
|
|||||
| Gene Name |
KLRG1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Idiopathic inflammatory myopathy [ICD-11: 4A41] | |||||
| Function |
Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells. {ECO:0000269|PubMed:19604491}.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MTDSVIYSMLELPTATQAQNDYGPQQKSSSSRPSCSCLVAIALGLLTAVLLSVLLYQWIL
CQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMS LLQVFLSEAFCWIGLRNNSGWRWEDGSPLNFSRISSNSFVQTCGAINKNGLQASSCEVPL HWVCKKCPFADQALF Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | ABC008 | Drug Info | Phase 2/3 | Inclusion body myositis | [2] | |
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Clinical pipeline report, company report or official report of Abcuro | |||||
| REF 2 | ClinicalTrials.gov (NCT05721573) A Phase II/III Randomized, Double-blind, Placebo-controlled, Multicenter Study to Evaluate the Efficacy and Safety of ABC008 in the Treatment of Subjects With Inclusion Body Myositis. U.S.National Institutes of Health. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.