Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T63174
|
|||||
| Target Name |
Interleukin-1 receptor antagonist protein (IL1RN)
|
|||||
| Synonyms |
IL-1RN; IL-1ra; IRAP; ICIL-1RA; IL1 inhibitor; Anakinra
Click to Show/Hide
|
|||||
| Gene Name |
IL1RN
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Osteoarthritis [ICD-11: FA00-FA05] | |||||
| Function |
Anti-inflammatory antagonist of interleukin-1 family of proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Protects from immune dysregulation and uncontrolled systemic inflammation triggered by IL1 for a range of innate stimulatory agents such as pathogens. {ECO:0000250|UniProtKB:P25085, ECO:0000269|PubMed:7775431}.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | GNSC-001 | Drug Info | Phase 1 | Osteoarthritis | [2] | |
| 2 | Humantakinogene hadenovec | Drug Info | Phase 1 | Osteoarthritis | [1] | |
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | ClinicalTrials.gov (NCT04119687) An Open-Label, Single Ascending Dose Study to Assess the Safety and Tolerability of FX201 in Patients With Osteoarthritis of the Knee. U.S.National Institutes of Health. | |||||
| REF 2 | ClinicalTrials.gov (NCT05835895) A Phase 1b, Randomized, Double-Blinded, Placebo-Controlled Dose Ranging Study to Evaluate Safety, Tolerability and Pharmacodynamics of a Single Intra-articular Injection of GNSC-001 Gene Therapy in Subjects With Osteoarthritis of the Knee. U.S.National Institutes of Health. | |||||
| REF 3 | Clinical pipeline report, company report or official report of Genascence | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.