Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T63140
(Former ID: TTDS00510)
|
|||||
| Target Name |
Bacterial Integral membrane LmrP (Bact lmrP)
|
|||||
| Synonyms |
lmrP; L24511; Integral membrane protein LmrP
Click to Show/Hide
|
|||||
| Gene Name |
Bact lmrP
|
|||||
| Target Type |
Successful target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Bacterial infection [ICD-11: 1A00-1C4Z] | |||||
| Function |
Major facilitator superfamily multidrug transporter from Lactococcus lactis that mediates the efflux of cationic amphiphilic substrates from the cell in a proton-motive force-dependent fashion.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MKEFWNLDKNLQLRLGIVFLGAFSYGTVFSSMTIYYNQHLGSAITGILLALSAVATFVAG
ILSGFFADRNGRKPVMVFGTVIQLLGALLAIDSNLPGHVNPWSTFIAFLLISFGYNLVIT AGNAMIIDASNAENRKVVFMLDYWAQNLSVILGAALSAWLFRPAFEALLVILLLTVLVSF FLTTFVMTETFRPIVKAKEEAENIFQAYKTVLQDKTYMIFMGANIATTFIIMQFDNFLPV HLSNSFKTITFFGFEIYGQRMLTIYLILACVLVVLLMTTLNRLTKDWSHQKGFIWGSLFM AIGMIFSFLTTTFTPIFIAGIVYTLGEIVYTPSVQTLGVDLMNPEKIGSYNGVAAIKMPI ASILAGLLVSISPMIKATGVSLVLALTEVLAIILVLIAVNRHQKTKIN Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Approved Drug(s) | [+] 1 Approved Drugs | + | ||||
| 1 | Quinupristin | Drug Info | Approved | Bacterial infection | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Modulator | [+] 1 Modulator drugs | + | ||||
| 1 | Quinupristin | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | The lactococcal secondary multidrug transporter LmrP confers resistance to lincosamides, macrolides, streptogramins and tetracyclines. Microbiology. 2001 Oct;147(Pt 10):2873-80. | |||||
| REF 2 | Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.