Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T62739
(Former ID: TTDI02269)
|
|||||
| Target Name |
STMN1 messenger RNA (STMN1 mRNA)
|
|||||
| Synonyms |
pp19 (mRNA); pp17 (mRNA); Stathmin (mRNA); Protein Pr22 (mRNA); Prosolin (mRNA); Phosphoprotein p19 (mRNA); Op18 (mRNA); Oncoprotein 18 (mRNA); Metablastin (mRNA); Leukemia-associated phosphoprotein p18 (mRNA); LAP18 (mRNA); C1orf215 (mRNA)
Click to Show/Hide
|
|||||
| Gene Name |
STMN1
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Solid tumour/cancer [ICD-11: 2A00-2F9Z] | |||||
| Function |
Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear. Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules.
Click to Show/Hide
|
|||||
| BioChemical Class |
mRNA target
|
|||||
| UniProt ID | ||||||
| Sequence |
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL ERLREKDKHIEEVRKNKESKDPADETEAD Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
| 1 | pbi-shRNA STMN1 | Drug Info | Phase 1 | Solid tumour/cancer | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 1 Inhibitor drugs | + | ||||
| 1 | pbi-shRNA STMN1 | Drug Info | [3] | |||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 2 KEGG Pathways | + | ||||
| 1 | MAPK signaling pathway | |||||
| 2 | MicroRNAs in cancer | |||||
| NetPath Pathway | [+] 1 NetPath Pathways | + | ||||
| 1 | TGF_beta_Receptor Signaling Pathway | |||||
| Panther Pathway | [+] 1 Panther Pathways | + | ||||
| 1 | Cytoskeletal regulation by Rho GTPase | |||||
| PID Pathway | [+] 2 PID Pathways | + | ||||
| 1 | Aurora B signaling | |||||
| 2 | Signaling mediated by p38-gamma and p38-delta | |||||
| WikiPathways | [+] 5 WikiPathways | + | ||||
| 1 | EGF/EGFR Signaling Pathway | |||||
| 2 | MAPK Signaling Pathway | |||||
| 3 | Retinoblastoma (RB) in Cancer | |||||
| 4 | Integrated Pancreatic Cancer Pathway | |||||
| 5 | Regulation of Microtubule Cytoskeleton | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | National Cancer Institute Drug Dictionary (drug id 722324). | |||||
| REF 2 | ClinicalTrials.gov (NCT01505153) Phase I Intratumoral Pbi-shRNA STMN1 LP in Advanced and/or Metastatic Cancer. U.S. National Institutes of Health. | |||||
| REF 3 | Clinical pipeline report, company report or official report of Gradalis. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.