Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T62187
(Former ID: TTDR00326)
|
|||||
| Target Name |
Herpes simplex virus Helicase-primase (HSV UL8)
|
|||||
| Synonyms |
Primase-associated factor; HEPA; DNA helicase/primase complex-associated protein
Click to Show/Hide
|
|||||
| Gene Name |
HSV UL8
|
|||||
| Target Type |
Clinical trial target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Herpes simplex infection [ICD-11: 1F00] | |||||
| Function |
Component of the helicase/primase complex. Unwinds the DNA at the replication forks and generates single-stranded DNA for both leading and lagging strand synthesis. The primase synthesizes short RNA primers on the lagging strand that the polymerase presumably elongates using dNTPs. The primase-associated factor has no known catalytic activity in the complex and may serve to facilitate the formation of the replisome by directly interacting with the origin-binding protein and the polymerase.
Click to Show/Hide
|
|||||
| BioChemical Class |
Acid anhydrides hydrolase
|
|||||
| UniProt ID | ||||||
| Sequence |
MDTADIVWVEESVSAITLYAVWLPPRAREYFHALVYFVCRNAAGEGRARFAEVSVTATEL
RDFYGSADVSVQAVVAAARAATTPAASPLEPLENPTLWRALYACVLAALERQTGPVALFA PLRIGSDPRTGLVVKVERASWGPPAAPRAALLVAEANIDIDPMALAARVAEHPDARLAWA RLAAIRDTPQCASAASLTVNITTGTALFAREYQTLAFPPIKKEGAFGDLVEVCEVGLRPR GHPQRVTARVLLPRDYDYFVSAGEKFSAPALVALFRQWHTTVHAAPGALAPVFAFLGPEF EVRGGPVPYFAVLGFPGWPTFTVPATAESARDLVRGAAAAYAALLGAWPAVGARVVLPPR AWPGVASAAAGCLLPAVREAVARWHPATKIIQLLDPPAAVGPVWTARFCFPGLRAQLLAA LADLGGSGLADPHGRTGLARLDALVVAAPSEPWAGAVLERLVPDTCNACPALRQLLGGVM AAVCLQIEETASSVKFAVCGGDGGAFWGVFNVDPQDADAASGVIEDARRAIETAVGAVLR ANAVRLRHPLCLALEGVYTHAVAWSQAGVWFWNSRDNTDHLGGFPLRGPAYTTAAGVVRD TLRRVLGLTTACVPEEDALTARGLMEDACDRLILDAFNKRLDAEYWSVRVSPFEASDPLP PTAFRGGALLDAEHYWRRVVRVCPGGGESVGVPVDLYPRPLVLPPVDCAHHLREILREIE LVFTGVLAGVWGEGGKFVYPFDDKMSFLFA Click to Show/Hide
|
|||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
| 1 | ASP-2151 | Drug Info | Phase 3 | Herpes simplex virus infection | [2] | |
| 2 | BAY 57-1293 | Drug Info | Phase 2 | Herpes simplex virus infection | [3] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 2 Inhibitor drugs | + | ||||
| 1 | ASP-2151 | Drug Info | [4] | |||
| 2 | BAY 57-1293 | Drug Info | [1] | |||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Co-Targets | Top | |||||
|---|---|---|---|---|---|---|
| Co-Targets | ||||||
| Target Profiles in Patients | Top | |||||
|---|---|---|---|---|---|---|
| Drug Resistance Mutation (DRM) | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Helicase primase: targeting the Achilles heel of herpes simplex viruses. Antivir Chem Chemother. 2004 May;15(3):135-40. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800025919) | |||||
| REF 3 | ClinicalTrials.gov (NCT01658826) Safety and Efficacy Comparator Trial of a New Drug Against Genital Herpes. U.S. National Institutes of Health. | |||||
| REF 4 | Efficacy of ASP2151, a helicase-primase inhibitor, against thymidine kinase-deficient herpes simplex virus type 2 infection in vitro and in vivo. Antiviral Res. 2012 Feb;93(2):301-4. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.