Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T56824
|
|||||
Target Name |
Vibrio TCP pilus virulence regulatory protein (Vibrio tcpN)
|
|||||
Gene Name |
Vibrio tcpN
|
|||||
Target Type |
Preclinical target
|
[1] | ||||
Disease | [+] 1 Target-related Diseases | + | ||||
1 | Pneumonia [ICD-11: CA40] | |||||
Function |
Probable regulatory protein for the tcp operon.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MIGKKSFQTNVYRMSKFDTYIFNNLYINDYKMFWIDSGIAKLIDKNCLVSYEINSSSIIL
LKKNSIQRFSLTSLSDENINVSVITISDSFIRSLKSYILGDLMIRNLYSENKDLLLWNCE HNDIAVLSEVVNGFREINYSDEFLKVFFSGFFSKVEKKYNSIFITDDLDAMEKISCLVKS DITRNWRWADICGELRTNRMILKKELESRGVKFRELINSIRISYSISLMKTGEFKIKQIA YQSGFASVSYFSTVFKSTMNVAPSEYLFMLTGVAEK Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | Virstatin | Drug Info | Preclinical | Acinetobacter baumannii infection | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Inhibitor | [+] 1 Inhibitor drugs | + | ||||
1 | Virstatin | Drug Info | [1] |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Virstatin inhibits dimerization of the transcriptional activator ToxT. Proc Natl Acad Sci U S A. 2007 Feb 13;104(7):2372-7. | |||||
REF 2 | Different drugs for bad bugs: antivirulence strategies in the age of antibiotic resistance. Nat Rev Drug Discov. 2017 Jul;16(7):457-471. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.