Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T54606
|
|||||
Target Name |
Staphylococcus Five leukocidin toxins (Stap-coc lukF)
|
|||||
Synonyms |
lukF
Click to Show/Hide
|
|||||
Gene Name |
Stap-coc lukF
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Medical/surgical procedure injury [ICD-11: PK80-PK81] | |||||
2 | Pneumonia [ICD-11: CA40] | |||||
Function |
Leukocidin causes cytotoxic changes in polymorphonuclear leukocytes. Gamma-hemolysin causes hemolysis in red blood cells.
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MKMNKLVKSSVATSMALLLLSGTANAEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQ
ILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSV NAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSR NTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLL SRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKS TYEIDWENHKVKLLDTKETENNK Click to Show/Hide
|
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 1 Clinical Trial Drugs | + | ||||
1 | ASN100 | Drug Info | Phase 2 | Ventilator-associated pneumonia | [2] | |
Mode of Action | [+] 1 Modes of Action | + | ||||
Modulator | [+] 1 Modulator drugs | + | ||||
1 | ASN100 | Drug Info | [1] |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Antibacterial antibodies gain traction. Nat Rev Drug Discov. 2015 Nov;14(11):737-8. | |||||
REF 2 | ClinicalTrials.gov (NCT02940626) Prevention of S. Aureus Pneumonia Study in Heavily Colonized, Mechanically Ventilated Subjects |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.