Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T54526
(Former ID: TTDR01085)
|
|||||
| Target Name |
Mycobacterium Bisphosphoglycerate phosphoglycerate mutase (MycB gpmI)
|
|||||
| Synonyms |
gpmI; Phosphoglyceromutase; Phosphoglycerate mutase; IPGM; BPG-independent PGAM
Click to Show/Hide
|
|||||
| Gene Name |
MycB gpmI
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate.
Click to Show/Hide
|
|||||
| BioChemical Class |
Intramolecular transferases
|
|||||
| UniProt ID | ||||||
| Sequence |
MHKKVLLAILDGYGISNAIYGNAVQNANTPMLDELINSYPCVLLDASGEAVGLPMGQIGN
SEVGHLNIGAGRVVYTGLSLINQHIKDRSFFANKAFLKTIEHVEKNHSKIHLIGLFSNGG VHSHNEHLLALIELFSKHAKVVLHLFGDGRDVAPCSLKQDLEKLMIFLKNYPNVVIGTIG GRYYGMDRDQRWDREMIAYKALLGVSKNKFNDPIGYIETQYQNQITDEFIYPAINANLNS DQFALNNNDGVIFFNFRPDRARQMSHLIFNSNYYNYQPELKRKENLFFVTMMNYEGIVPS EFAFPPQTIKNSLGEVIANNNLKQLRIAETEKYAHVTFFFDGGFEVNLSNETKTLIPSLK VATYDLAPEMSCKAITDALLEKLNNFDFTVLNFANPDMVGHTGNYQACIKALEALDVQIK RIVDFCKANQITMFLTADHGNAEVMIDNNNNPVTKHTINPVPFVCTDKNVNFNQTGILAN IAPTILEYLNLSKPKEMTAKSLLKNNN Click to Show/Hide
|
|||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target Affiliated Biological Pathways | Top | |||||
|---|---|---|---|---|---|---|
| KEGG Pathway | [+] 9 KEGG Pathways | + | ||||
| 1 | Glycolysis / Gluconeogenesis | |||||
| 2 | Glycine, serine and threonine metabolism | |||||
| 3 | Methane metabolism | |||||
| 4 | Metabolic pathways | |||||
| 5 | Biosynthesis of secondary metabolites | |||||
| 6 | Microbial metabolism in diverse environments | |||||
| 7 | Biosynthesis of antibiotics | |||||
| 8 | Carbon metabolism | |||||
| 9 | Biosynthesis of amino acids | |||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 2 | Modes of action of anthelmintic drugs. Vet J. 1997 Jul;154(1):11-34. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.