Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T50678
(Former ID: TTDI02681)
|
|||||
Target Name |
CD40LG messenger RNA (CD40LG mRNA)
|
|||||
Synonyms |
Tumor necrosis factor ligand superfamily member 5 (mRNA); TRAP (mRNA); TNFSF5 (mRNA); TNF-related activation protein (mRNA); T-cell antigen Gp39 (mRNA); T cell antigen Gp39 (mRNA); CD40L (mRNA); CD40-L (mRNA); CD40 ligand (mRNA); CD154 antigen (mRNA); CD154 (mRNA)
Click to Show/Hide
|
|||||
Gene Name |
CD40LG
|
|||||
Target Type |
Literature-reported target
|
[1] | ||||
Function |
Costimulates T-cell proliferation and cytokine production. Its cross-linking on T-cells generates a costimulatory signal which enhances the production of IL4 and IL10 in conjunction with the TCR/CD3 ligation and CD28 costimulation. Induces the activation of NF-kappa-B and kinases MAPK8 and PAK2 in T-cells. Induces tyrosine phosphorylation of isoform 3 of CD28. Mediates B-cell proliferation in the absence of co-stimulus as well as IgE production in the presence of IL4. Involved in immunoglobulin class switching. Cytokine that binds to CD40/TNFRSF5.
Click to Show/Hide
|
|||||
BioChemical Class |
mRNA target
|
|||||
UniProt ID | ||||||
Sequence |
MIETYNQTSPRSAATGLPISMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNTGERSLSLLNCEEIKSQFEGFVKDIMLNKEETKKENSFEMQKGDQNP QIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSN REASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVN VTDPSQVSHGTGFTSFGLLKL Click to Show/Hide
|
Cell-based Target Expression Variations | Top | |||||
---|---|---|---|---|---|---|
Cell-based Target Expression Variations |
Target Profiles in Patients | Top | |||||
---|---|---|---|---|---|---|
Target Expression Profile (TEP) |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | NCBI GEO: archive for functional genomics data sets--update. Nucleic Acids Res. 2013 Jan;41(Database issue):D991-5. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.