Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T46541
(Former ID: TTDI00230)
|
|||||
| Target Name |
Borealin (CDCA8)
|
|||||
| Synonyms |
hDasraB; hDasra-B; Pluripotent embryonic stem cellrelated gene 3 protein; Pluripotent embryonic stem cell-related gene 3 protein; PESCRG3; DasraB; Dasra-B; Dasra B; Cell division cycleassociated protein 8; Cell division cycle-associated protein 8
Click to Show/Hide
|
|||||
| Gene Name |
CDCA8
|
|||||
| Target Type |
Literature-reported target
|
[1] | ||||
| Function |
The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Major effector of the TTK kinase in the control of attachment-error-correction and chromosome alignment. Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis.
Click to Show/Hide
|
|||||
| UniProt ID | ||||||
| Sequence |
MAPRKGSSRVAKTNSLRRRKLASFLKDFDREVEIRIKQIESDRQNLLKEVDNLYNIEILR
LPKALREMNWLDYFALGGNKQALEEAATADLDITEINKLTAEAIQTPLKSAKTRKVIQVD EMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVS MVKPTPGLTPRFDSRVFKTPGLRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLR LLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | AlphaFold | ||||
| Cell-based Target Expression Variations | Top | |||||
|---|---|---|---|---|---|---|
| Cell-based Target Expression Variations | ||||||
| Different Human System Profiles of Target | Top |
|---|---|
|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Biological Network Descriptors
of target is determined based on a human protein-protein interactions (PPI) network consisting of 9,309 proteins and 52,713 PPIs, which were with a high confidence score of ≥ 0.95 collected from STRING database.
The network properties of targets based on protein-protein interactions (PPIs) have been widely adopted for the assessment of target’s druggability. Proteins with high node degree tend to have a high impact on network function through multiple interactions, while proteins with high betweenness centrality are regarded to be central for communication in interaction networks and regulate the flow of signaling information
(Front Pharmacol, 9, 1245, 2018;
Curr Opin Struct Biol. 44:134-142, 2017).
Human Similarity Proteins
Biological Network Descriptors
|
|
|
There is no similarity protein (E value < 0.005) for this target
|
| Degree | 36 | Degree centrality | 3.87E-03 | Betweenness centrality | 6.74E-05 |
|---|---|---|---|---|---|
| Closeness centrality | 2.19E-01 | Radiality | 1.38E+01 | Clustering coefficient | 6.30E-01 |
| Neighborhood connectivity | 4.40E+01 | Topological coefficient | 1.44E-01 | Eccentricity | 13 |
| Download | Click to Download the Full PPI Network of This Target | ||||
| Target Regulators | Top | |||||
|---|---|---|---|---|---|---|
| Target-interacting Proteins | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Hepatic Loss of Borealin Impairs Postnatal Liver Development, Regeneration, and Hepatocarcinogenesis. J Biol Chem. 2016 Sep 30;291(40):21137-21147. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.