Target Information
Target General Information | Top | |||||
---|---|---|---|---|---|---|
Target ID |
T46526
|
|||||
Target Name |
Bacterial Fimbrin D-mannose adhesin (Bact FimH)
|
|||||
Synonyms |
fimH; b4320; Type 1 fimbrin D-mannose specific adhesin; Protein FimH; JW4283
Click to Show/Hide
|
|||||
Gene Name |
Bact FimH
|
|||||
Target Type |
Clinical trial target
|
[1] | ||||
Disease | [+] 2 Target-related Diseases | + | ||||
1 | Crohn disease [ICD-11: DD70] | |||||
2 | Urinary tract infection [ICD-11: GC08] | |||||
Function |
Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed. Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae).
Click to Show/Hide
|
|||||
UniProt ID | ||||||
Sequence |
MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLS
TQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRT DKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG GCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQ GVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ Click to Show/Hide
|
|||||
3D Structure | Click to Show 3D Structure of This Target | PDB |
Drugs and Modes of Action | Top | |||||
---|---|---|---|---|---|---|
Clinical Trial Drug(s) | [+] 2 Clinical Trial Drugs | + | ||||
1 | EB8018 | Drug Info | Phase 2 | Crohn disease | [2] | |
2 | GSK3882347 | Drug Info | Phase 1 | Urinary tract infection | [3] | |
Patented Agent(s) | [+] 188 Patented Agents | + | ||||
1 | Alkyl mannoside derivative 1 | Drug Info | Patented | Crohn disease | [1] | |
2 | Alkyl mannoside derivative 10 | Drug Info | Patented | Crohn disease | [1] | |
3 | Alkyl mannoside derivative 11 | Drug Info | Patented | Crohn disease | [1] | |
4 | Alkyl mannoside derivative 12 | Drug Info | Patented | Crohn disease | [1] | |
5 | Alkyl mannoside derivative 2 | Drug Info | Patented | Crohn disease | [1] | |
6 | Alkyl mannoside derivative 3 | Drug Info | Patented | Crohn disease | [1] | |
7 | Alkyl mannoside derivative 4 | Drug Info | Patented | Crohn disease | [1] | |
8 | Alkyl mannoside derivative 5 | Drug Info | Patented | Crohn disease | [1] | |
9 | Alkyl mannoside derivative 6 | Drug Info | Patented | Crohn disease | [1] | |
10 | Alkyl mannoside derivative 7 | Drug Info | Patented | Crohn disease | [1] | |
11 | Alkyl mannoside derivative 8 | Drug Info | Patented | Crohn disease | [1] | |
12 | Alkyl mannoside derivative 9 | Drug Info | Patented | Crohn disease | [1] | |
13 | Aryl mannoside derivative 1 | Drug Info | Patented | Crohn disease | [1] | |
14 | Aryl mannoside derivative 10 | Drug Info | Patented | Crohn disease | [1] | |
15 | Aryl mannoside derivative 11 | Drug Info | Patented | Crohn disease | [1] | |
16 | Aryl mannoside derivative 12 | Drug Info | Patented | Crohn disease | [1] | |
17 | Aryl mannoside derivative 13 | Drug Info | Patented | Crohn disease | [1] | |
18 | Aryl mannoside derivative 14 | Drug Info | Patented | Crohn disease | [1] | |
19 | Aryl mannoside derivative 15 | Drug Info | Patented | Crohn disease | [1] | |
20 | Aryl mannoside derivative 16 | Drug Info | Patented | Crohn disease | [1] | |
21 | Aryl mannoside derivative 17 | Drug Info | Patented | Crohn disease | [1] | |
22 | Aryl mannoside derivative 18 | Drug Info | Patented | Crohn disease | [1] | |
23 | Aryl mannoside derivative 19 | Drug Info | Patented | Crohn disease | [1] | |
24 | Aryl mannoside derivative 2 | Drug Info | Patented | Crohn disease | [1] | |
25 | Aryl mannoside derivative 20 | Drug Info | Patented | Crohn disease | [1] | |
26 | Aryl mannoside derivative 21 | Drug Info | Patented | Crohn disease | [1] | |
27 | Aryl mannoside derivative 22 | Drug Info | Patented | Crohn disease | [1] | |
28 | Aryl mannoside derivative 23 | Drug Info | Patented | Crohn disease | [1] | |
29 | Aryl mannoside derivative 3 | Drug Info | Patented | Crohn disease | [1] | |
30 | Aryl mannoside derivative 4 | Drug Info | Patented | Crohn disease | [1] | |
31 | Aryl mannoside derivative 5 | Drug Info | Patented | Crohn disease | [1] | |
32 | Aryl mannoside derivative 6 | Drug Info | Patented | Crohn disease | [1] | |
33 | Aryl mannoside derivative 7 | Drug Info | Patented | Crohn disease | [1] | |
34 | Aryl mannoside derivative 8 | Drug Info | Patented | Crohn disease | [1] | |
35 | Aryl mannoside derivative 9 | Drug Info | Patented | Crohn disease | [1] | |
36 | Beta-cyclodextrin conjugate derivative 1 | Drug Info | Patented | Crohn disease | [1] | |
37 | Beta-cyclodextrin conjugate derivative 2 | Drug Info | Patented | Crohn disease | [1] | |
38 | Beta-cyclodextrin conjugate derivative 3 | Drug Info | Patented | Crohn disease | [1] | |
39 | Beta-cyclodextrin conjugate derivative 4 | Drug Info | Patented | Crohn disease | [1] | |
40 | Beta-cyclodextrin conjugate derivative 5 | Drug Info | Patented | Crohn disease | [1] | |
41 | Biaryl mannoside derivative 1 | Drug Info | Patented | Crohn disease | [1] | |
42 | Biaryl mannoside derivative 10 | Drug Info | Patented | Crohn disease | [1] | |
43 | Biaryl mannoside derivative 11 | Drug Info | Patented | Crohn disease | [1] | |
44 | Biaryl mannoside derivative 12 | Drug Info | Patented | Crohn disease | [1] | |
45 | Biaryl mannoside derivative 13 | Drug Info | Patented | Crohn disease | [1] | |
46 | Biaryl mannoside derivative 14 | Drug Info | Patented | Crohn disease | [1] | |
47 | Biaryl mannoside derivative 15 | Drug Info | Patented | Crohn disease | [1] | |
48 | Biaryl mannoside derivative 16 | Drug Info | Patented | Crohn disease | [1] | |
49 | Biaryl mannoside derivative 17 | Drug Info | Patented | Crohn disease | [1] | |
50 | Biaryl mannoside derivative 18 | Drug Info | Patented | Crohn disease | [1] | |
51 | Biaryl mannoside derivative 19 | Drug Info | Patented | Crohn disease | [1] | |
52 | Biaryl mannoside derivative 2 | Drug Info | Patented | Crohn disease | [1] | |
53 | Biaryl mannoside derivative 20 | Drug Info | Patented | Crohn disease | [1] | |
54 | Biaryl mannoside derivative 21 | Drug Info | Patented | Crohn disease | [1] | |
55 | Biaryl mannoside derivative 22 | Drug Info | Patented | Crohn disease | [1] | |
56 | Biaryl mannoside derivative 23 | Drug Info | Patented | Crohn disease | [1] | |
57 | Biaryl mannoside derivative 24 | Drug Info | Patented | Crohn disease | [1] | |
58 | Biaryl mannoside derivative 25 | Drug Info | Patented | Crohn disease | [1] | |
59 | Biaryl mannoside derivative 26 | Drug Info | Patented | Crohn disease | [1] | |
60 | Biaryl mannoside derivative 27 | Drug Info | Patented | Crohn disease | [1] | |
61 | Biaryl mannoside derivative 28 | Drug Info | Patented | Crohn disease | [1] | |
62 | Biaryl mannoside derivative 29 | Drug Info | Patented | Crohn disease | [1] | |
63 | Biaryl mannoside derivative 3 | Drug Info | Patented | Crohn disease | [1] | |
64 | Biaryl mannoside derivative 30 | Drug Info | Patented | Crohn disease | [1] | |
65 | Biaryl mannoside derivative 31 | Drug Info | Patented | Crohn disease | [1] | |
66 | Biaryl mannoside derivative 4 | Drug Info | Patented | Crohn disease | [1] | |
67 | Biaryl mannoside derivative 5 | Drug Info | Patented | Crohn disease | [1] | |
68 | Biaryl mannoside derivative 6 | Drug Info | Patented | Crohn disease | [1] | |
69 | Biaryl mannoside derivative 7 | Drug Info | Patented | Crohn disease | [1] | |
70 | Biaryl mannoside derivative 8 | Drug Info | Patented | Crohn disease | [1] | |
71 | Biaryl mannoside derivative 9 | Drug Info | Patented | Crohn disease | [1] | |
72 | Biphenyl mannoside derivative 1 | Drug Info | Patented | Crohn disease | [1] | |
73 | Biphenyl mannoside derivative 10 | Drug Info | Patented | Crohn disease | [1] | |
74 | Biphenyl mannoside derivative 11 | Drug Info | Patented | Crohn disease | [1] | |
75 | Biphenyl mannoside derivative 12 | Drug Info | Patented | Crohn disease | [1] | |
76 | Biphenyl mannoside derivative 13 | Drug Info | Patented | Crohn disease | [1] | |
77 | Biphenyl mannoside derivative 14 | Drug Info | Patented | Crohn disease | [1] | |
78 | Biphenyl mannoside derivative 15 | Drug Info | Patented | Crohn disease | [1] | |
79 | Biphenyl mannoside derivative 16 | Drug Info | Patented | Crohn disease | [1] | |
80 | Biphenyl mannoside derivative 17 | Drug Info | Patented | Crohn disease | [1] | |
81 | Biphenyl mannoside derivative 18 | Drug Info | Patented | Crohn disease | [1] | |
82 | Biphenyl mannoside derivative 19 | Drug Info | Patented | Crohn disease | [1] | |
83 | Biphenyl mannoside derivative 2 | Drug Info | Patented | Crohn disease | [1] | |
84 | Biphenyl mannoside derivative 20 | Drug Info | Patented | Crohn disease | [1] | |
85 | Biphenyl mannoside derivative 21 | Drug Info | Patented | Crohn disease | [1] | |
86 | Biphenyl mannoside derivative 22 | Drug Info | Patented | Crohn disease | [1] | |
87 | Biphenyl mannoside derivative 23 | Drug Info | Patented | Crohn disease | [1] | |
88 | Biphenyl mannoside derivative 24 | Drug Info | Patented | Crohn disease | [1] | |
89 | Biphenyl mannoside derivative 25 | Drug Info | Patented | Crohn disease | [1] | |
90 | Biphenyl mannoside derivative 26 | Drug Info | Patented | Crohn disease | [1] | |
91 | Biphenyl mannoside derivative 27 | Drug Info | Patented | Crohn disease | [1] | |
92 | Biphenyl mannoside derivative 28 | Drug Info | Patented | Crohn disease | [1] | |
93 | Biphenyl mannoside derivative 29 | Drug Info | Patented | Crohn disease | [1] | |
94 | Biphenyl mannoside derivative 3 | Drug Info | Patented | Crohn disease | [1] | |
95 | Biphenyl mannoside derivative 30 | Drug Info | Patented | Crohn disease | [1] | |
96 | Biphenyl mannoside derivative 4 | Drug Info | Patented | Crohn disease | [1] | |
97 | Biphenyl mannoside derivative 5 | Drug Info | Patented | Crohn disease | [1] | |
98 | Biphenyl mannoside derivative 6 | Drug Info | Patented | Crohn disease | [1] | |
99 | Biphenyl mannoside derivative 7 | Drug Info | Patented | Crohn disease | [1] | |
100 | Biphenyl mannoside derivative 8 | Drug Info | Patented | Crohn disease | [1] | |
101 | Biphenyl mannoside derivative 9 | Drug Info | Patented | Crohn disease | [1] | |
102 | C-linked disaccharide biphenyl mannoside derivative 1 | Drug Info | Patented | Crohn disease | [1] | |
103 | C-linked disaccharide biphenyl mannoside derivative 2 | Drug Info | Patented | Crohn disease | [1] | |
104 | C-linked disaccharide biphenyl mannoside derivative 3 | Drug Info | Patented | Crohn disease | [1] | |
105 | C-linked disaccharide biphenyl mannoside derivative 4 | Drug Info | Patented | Crohn disease | [1] | |
106 | C-linked disaccharide biphenyl mannoside derivative 5 | Drug Info | Patented | Crohn disease | [1] | |
107 | C-linked disaccharide biphenyl mannoside derivative 6 | Drug Info | Patented | Crohn disease | [1] | |
108 | Mannoside derivative 1 | Drug Info | Patented | Crohn disease | [1] | |
109 | Mannoside derivative 10 | Drug Info | Patented | Crohn disease | [1] | |
110 | Mannoside derivative 11 | Drug Info | Patented | Crohn disease | [1] | |
111 | Mannoside derivative 12 | Drug Info | Patented | Crohn disease | [1] | |
112 | Mannoside derivative 13 | Drug Info | Patented | Crohn disease | [1] | |
113 | Mannoside derivative 2 | Drug Info | Patented | Crohn disease | [1] | |
114 | Mannoside derivative 3 | Drug Info | Patented | Crohn disease | [1] | |
115 | Mannoside derivative 4 | Drug Info | Patented | Crohn disease | [1] | |
116 | Mannoside derivative 5 | Drug Info | Patented | Crohn disease | [1] | |
117 | Mannoside derivative 6 | Drug Info | Patented | Crohn disease | [1] | |
118 | Mannoside derivative 7 | Drug Info | Patented | Crohn disease | [1] | |
119 | Mannoside derivative 8 | Drug Info | Patented | Crohn disease | [1] | |
120 | Mannoside derivative 9 | Drug Info | Patented | Crohn disease | [1] | |
121 | PMID26651364-Compound-105 | Drug Info | Patented | Crohn disease | [1] | |
122 | PMID26651364-Compound-106 | Drug Info | Patented | Crohn disease | [1] | |
123 | PMID26651364-Compound-107 | Drug Info | Patented | Crohn disease | [1] | |
124 | PMID26651364-Compound-108 | Drug Info | Patented | Crohn disease | [1] | |
125 | PMID26651364-Compound-109 | Drug Info | Patented | Crohn disease | [1] | |
126 | PMID26651364-Compound-10a | Drug Info | Patented | Crohn disease | [1] | |
127 | PMID26651364-Compound-10b | Drug Info | Patented | Crohn disease | [1] | |
128 | PMID26651364-Compound-10c | Drug Info | Patented | Crohn disease | [1] | |
129 | PMID26651364-Compound-10d | Drug Info | Patented | Crohn disease | [1] | |
130 | PMID26651364-Compound-110 | Drug Info | Patented | Crohn disease | [1] | |
131 | PMID26651364-Compound-111 | Drug Info | Patented | Crohn disease | [1] | |
132 | PMID26651364-Compound-112 | Drug Info | Patented | Crohn disease | [1] | |
133 | PMID26651364-Compound-113 | Drug Info | Patented | Crohn disease | [1] | |
134 | PMID26651364-Compound-114 | Drug Info | Patented | Crohn disease | [1] | |
135 | PMID26651364-Compound-115 | Drug Info | Patented | Crohn disease | [1] | |
136 | PMID26651364-Compound-116 | Drug Info | Patented | Crohn disease | [1] | |
137 | PMID26651364-Compound-117a | Drug Info | Patented | Crohn disease | [1] | |
138 | PMID26651364-Compound-117b | Drug Info | Patented | Crohn disease | [1] | |
139 | PMID26651364-Compound-118 | Drug Info | Patented | Crohn disease | [1] | |
140 | PMID26651364-Compound-119 | Drug Info | Patented | Crohn disease | [1] | |
141 | PMID26651364-Compound-11b | Drug Info | Patented | Crohn disease | [1] | |
142 | PMID26651364-Compound-11c | Drug Info | Patented | Crohn disease | [1] | |
143 | PMID26651364-Compound-120 | Drug Info | Patented | Crohn disease | [1] | |
144 | PMID26651364-Compound-121 | Drug Info | Patented | Crohn disease | [1] | |
145 | PMID26651364-Compound-122 | Drug Info | Patented | Crohn disease | [1] | |
146 | PMID26651364-Compound-123 | Drug Info | Patented | Crohn disease | [1] | |
147 | PMID26651364-Compound-124 | Drug Info | Patented | Crohn disease | [1] | |
148 | PMID26651364-Compound-125 | Drug Info | Patented | Crohn disease | [1] | |
149 | PMID26651364-Compound-126a | Drug Info | Patented | Crohn disease | [1] | |
150 | PMID26651364-Compound-126b | Drug Info | Patented | Crohn disease | [1] | |
151 | PMID26651364-Compound-126c | Drug Info | Patented | Crohn disease | [1] | |
152 | PMID26651364-Compound-127 | Drug Info | Patented | Crohn disease | [1] | |
153 | PMID26651364-Compound-128 | Drug Info | Patented | Crohn disease | [1] | |
154 | PMID26651364-Compound-4 | Drug Info | Patented | Crohn disease | [1] | |
155 | PMID26651364-Compound-45 | Drug Info | Patented | Crohn disease | [1] | |
156 | PMID26651364-Compound-46 | Drug Info | Patented | Crohn disease | [1] | |
157 | PMID26651364-Compound-47 | Drug Info | Patented | Crohn disease | [1] | |
158 | PMID26651364-Compound-48 | Drug Info | Patented | Crohn disease | [1] | |
159 | PMID26651364-Compound-49 | Drug Info | Patented | Crohn disease | [1] | |
160 | PMID26651364-Compound-5 | Drug Info | Patented | Crohn disease | [1] | |
161 | PMID26651364-Compound-50 | Drug Info | Patented | Crohn disease | [1] | |
162 | PMID26651364-Compound-5a | Drug Info | Patented | Crohn disease | [1] | |
163 | PMID26651364-Compound-5b | Drug Info | Patented | Crohn disease | [1] | |
164 | PMID26651364-Compound-5c | Drug Info | Patented | Crohn disease | [1] | |
165 | PMID26651364-Compound-5d | Drug Info | Patented | Crohn disease | [1] | |
166 | PMID26651364-Compound-5e | Drug Info | Patented | Crohn disease | [1] | |
167 | PMID26651364-Compound-5f | Drug Info | Patented | Crohn disease | [1] | |
168 | PMID26651364-Compound-5g | Drug Info | Patented | Crohn disease | [1] | |
169 | PMID26651364-Compound-6a | Drug Info | Patented | Crohn disease | [1] | |
170 | PMID26651364-Compound-6b | Drug Info | Patented | Crohn disease | [1] | |
171 | PMID26651364-Compound-6c | Drug Info | Patented | Crohn disease | [1] | |
172 | PMID26651364-Compound-6d | Drug Info | Patented | Crohn disease | [1] | |
173 | PMID26651364-Compound-6e | Drug Info | Patented | Crohn disease | [1] | |
174 | PMID26651364-Compound-7a | Drug Info | Patented | Crohn disease | [1] | |
175 | PMID26651364-Compound-7b | Drug Info | Patented | Crohn disease | [1] | |
176 | PMID26651364-Compound-7c | Drug Info | Patented | Crohn disease | [1] | |
177 | PMID26651364-Compound-7d | Drug Info | Patented | Crohn disease | [1] | |
178 | PMID26651364-Compound-7e | Drug Info | Patented | Crohn disease | [1] | |
179 | PMID26651364-Compound-8a | Drug Info | Patented | Crohn disease | [1] | |
180 | PMID26651364-Compound-8b | Drug Info | Patented | Crohn disease | [1] | |
181 | PMID26651364-Compound-8c | Drug Info | Patented | Crohn disease | [1] | |
182 | PMID26651364-Compound-8d | Drug Info | Patented | Crohn disease | [1] | |
183 | PMID26651364-Compound-9a | Drug Info | Patented | Crohn disease | [1] | |
184 | PMID26651364-Compound-9b | Drug Info | Patented | Crohn disease | [1] | |
185 | PMID26651364-Compound-9c | Drug Info | Patented | Crohn disease | [1] | |
186 | PMID26651364-Compound-9d | Drug Info | Patented | Crohn disease | [1] | |
187 | PMID26651364-Compound-9e | Drug Info | Patented | Crohn disease | [1] | |
188 | PMID26651364-Compound-9f | Drug Info | Patented | Crohn disease | [1] | |
Preclinical Drug(s) | [+] 1 Preclinical Drugs | + | ||||
1 | mAb926 | Drug Info | Preclinical | Urinary tract infection | [4] | |
Mode of Action | [+] 2 Modes of Action | + | ||||
Inhibitor | [+] 2 Inhibitor drugs | + | ||||
1 | EB8018 | Drug Info | [5] | |||
2 | mAb926 | Drug Info | [8] | |||
Antagonist | [+] 190 Antagonist drugs | + | ||||
1 | GSK3882347 | Drug Info | [6] | |||
2 | GSK3882347 | Drug Info | [7] | |||
3 | Alkyl mannoside derivative 1 | Drug Info | [1] | |||
4 | Alkyl mannoside derivative 10 | Drug Info | [1] | |||
5 | Alkyl mannoside derivative 11 | Drug Info | [1] | |||
6 | Alkyl mannoside derivative 12 | Drug Info | [1] | |||
7 | Alkyl mannoside derivative 2 | Drug Info | [1] | |||
8 | Alkyl mannoside derivative 3 | Drug Info | [1] | |||
9 | Alkyl mannoside derivative 4 | Drug Info | [1] | |||
10 | Alkyl mannoside derivative 5 | Drug Info | [1] | |||
11 | Alkyl mannoside derivative 6 | Drug Info | [1] | |||
12 | Alkyl mannoside derivative 7 | Drug Info | [1] | |||
13 | Alkyl mannoside derivative 8 | Drug Info | [1] | |||
14 | Alkyl mannoside derivative 9 | Drug Info | [1] | |||
15 | Aryl mannoside derivative 1 | Drug Info | [1] | |||
16 | Aryl mannoside derivative 10 | Drug Info | [1] | |||
17 | Aryl mannoside derivative 11 | Drug Info | [1] | |||
18 | Aryl mannoside derivative 12 | Drug Info | [1] | |||
19 | Aryl mannoside derivative 13 | Drug Info | [1] | |||
20 | Aryl mannoside derivative 14 | Drug Info | [1] | |||
21 | Aryl mannoside derivative 15 | Drug Info | [1] | |||
22 | Aryl mannoside derivative 16 | Drug Info | [1] | |||
23 | Aryl mannoside derivative 17 | Drug Info | [1] | |||
24 | Aryl mannoside derivative 18 | Drug Info | [1] | |||
25 | Aryl mannoside derivative 19 | Drug Info | [1] | |||
26 | Aryl mannoside derivative 2 | Drug Info | [1] | |||
27 | Aryl mannoside derivative 20 | Drug Info | [1] | |||
28 | Aryl mannoside derivative 21 | Drug Info | [1] | |||
29 | Aryl mannoside derivative 22 | Drug Info | [1] | |||
30 | Aryl mannoside derivative 23 | Drug Info | [1] | |||
31 | Aryl mannoside derivative 3 | Drug Info | [1] | |||
32 | Aryl mannoside derivative 4 | Drug Info | [1] | |||
33 | Aryl mannoside derivative 5 | Drug Info | [1] | |||
34 | Aryl mannoside derivative 6 | Drug Info | [1] | |||
35 | Aryl mannoside derivative 7 | Drug Info | [1] | |||
36 | Aryl mannoside derivative 8 | Drug Info | [1] | |||
37 | Aryl mannoside derivative 9 | Drug Info | [1] | |||
38 | Beta-cyclodextrin conjugate derivative 1 | Drug Info | [1] | |||
39 | Beta-cyclodextrin conjugate derivative 2 | Drug Info | [1] | |||
40 | Beta-cyclodextrin conjugate derivative 3 | Drug Info | [1] | |||
41 | Beta-cyclodextrin conjugate derivative 4 | Drug Info | [1] | |||
42 | Beta-cyclodextrin conjugate derivative 5 | Drug Info | [1] | |||
43 | Biaryl mannoside derivative 1 | Drug Info | [1] | |||
44 | Biaryl mannoside derivative 10 | Drug Info | [1] | |||
45 | Biaryl mannoside derivative 11 | Drug Info | [1] | |||
46 | Biaryl mannoside derivative 12 | Drug Info | [1] | |||
47 | Biaryl mannoside derivative 13 | Drug Info | [1] | |||
48 | Biaryl mannoside derivative 14 | Drug Info | [1] | |||
49 | Biaryl mannoside derivative 15 | Drug Info | [1] | |||
50 | Biaryl mannoside derivative 16 | Drug Info | [1] | |||
51 | Biaryl mannoside derivative 17 | Drug Info | [1] | |||
52 | Biaryl mannoside derivative 18 | Drug Info | [1] | |||
53 | Biaryl mannoside derivative 19 | Drug Info | [1] | |||
54 | Biaryl mannoside derivative 2 | Drug Info | [1] | |||
55 | Biaryl mannoside derivative 20 | Drug Info | [1] | |||
56 | Biaryl mannoside derivative 21 | Drug Info | [1] | |||
57 | Biaryl mannoside derivative 22 | Drug Info | [1] | |||
58 | Biaryl mannoside derivative 23 | Drug Info | [1] | |||
59 | Biaryl mannoside derivative 24 | Drug Info | [1] | |||
60 | Biaryl mannoside derivative 25 | Drug Info | [1] | |||
61 | Biaryl mannoside derivative 26 | Drug Info | [1] | |||
62 | Biaryl mannoside derivative 27 | Drug Info | [1] | |||
63 | Biaryl mannoside derivative 28 | Drug Info | [1] | |||
64 | Biaryl mannoside derivative 29 | Drug Info | [1] | |||
65 | Biaryl mannoside derivative 3 | Drug Info | [1] | |||
66 | Biaryl mannoside derivative 30 | Drug Info | [1] | |||
67 | Biaryl mannoside derivative 31 | Drug Info | [1] | |||
68 | Biaryl mannoside derivative 4 | Drug Info | [1] | |||
69 | Biaryl mannoside derivative 5 | Drug Info | [1] | |||
70 | Biaryl mannoside derivative 6 | Drug Info | [1] | |||
71 | Biaryl mannoside derivative 7 | Drug Info | [1] | |||
72 | Biaryl mannoside derivative 8 | Drug Info | [1] | |||
73 | Biaryl mannoside derivative 9 | Drug Info | [1] | |||
74 | Biphenyl mannoside derivative 1 | Drug Info | [1] | |||
75 | Biphenyl mannoside derivative 10 | Drug Info | [1] | |||
76 | Biphenyl mannoside derivative 11 | Drug Info | [1] | |||
77 | Biphenyl mannoside derivative 12 | Drug Info | [1] | |||
78 | Biphenyl mannoside derivative 13 | Drug Info | [1] | |||
79 | Biphenyl mannoside derivative 14 | Drug Info | [1] | |||
80 | Biphenyl mannoside derivative 15 | Drug Info | [1] | |||
81 | Biphenyl mannoside derivative 16 | Drug Info | [1] | |||
82 | Biphenyl mannoside derivative 17 | Drug Info | [1] | |||
83 | Biphenyl mannoside derivative 18 | Drug Info | [1] | |||
84 | Biphenyl mannoside derivative 19 | Drug Info | [1] | |||
85 | Biphenyl mannoside derivative 2 | Drug Info | [1] | |||
86 | Biphenyl mannoside derivative 20 | Drug Info | [1] | |||
87 | Biphenyl mannoside derivative 21 | Drug Info | [1] | |||
88 | Biphenyl mannoside derivative 22 | Drug Info | [1] | |||
89 | Biphenyl mannoside derivative 23 | Drug Info | [1] | |||
90 | Biphenyl mannoside derivative 24 | Drug Info | [1] | |||
91 | Biphenyl mannoside derivative 25 | Drug Info | [1] | |||
92 | Biphenyl mannoside derivative 26 | Drug Info | [1] | |||
93 | Biphenyl mannoside derivative 27 | Drug Info | [1] | |||
94 | Biphenyl mannoside derivative 28 | Drug Info | [1] | |||
95 | Biphenyl mannoside derivative 29 | Drug Info | [1] | |||
96 | Biphenyl mannoside derivative 3 | Drug Info | [1] | |||
97 | Biphenyl mannoside derivative 30 | Drug Info | [1] | |||
98 | Biphenyl mannoside derivative 4 | Drug Info | [1] | |||
99 | Biphenyl mannoside derivative 5 | Drug Info | [1] | |||
100 | Biphenyl mannoside derivative 6 | Drug Info | [1] | |||
101 | Biphenyl mannoside derivative 7 | Drug Info | [1] | |||
102 | Biphenyl mannoside derivative 8 | Drug Info | [1] | |||
103 | Biphenyl mannoside derivative 9 | Drug Info | [1] | |||
104 | C-linked disaccharide biphenyl mannoside derivative 1 | Drug Info | [1] | |||
105 | C-linked disaccharide biphenyl mannoside derivative 2 | Drug Info | [1] | |||
106 | C-linked disaccharide biphenyl mannoside derivative 3 | Drug Info | [1] | |||
107 | C-linked disaccharide biphenyl mannoside derivative 4 | Drug Info | [1] | |||
108 | C-linked disaccharide biphenyl mannoside derivative 5 | Drug Info | [1] | |||
109 | C-linked disaccharide biphenyl mannoside derivative 6 | Drug Info | [1] | |||
110 | Mannoside derivative 1 | Drug Info | [1] | |||
111 | Mannoside derivative 10 | Drug Info | [1] | |||
112 | Mannoside derivative 11 | Drug Info | [1] | |||
113 | Mannoside derivative 12 | Drug Info | [1] | |||
114 | Mannoside derivative 13 | Drug Info | [1] | |||
115 | Mannoside derivative 2 | Drug Info | [1] | |||
116 | Mannoside derivative 3 | Drug Info | [1] | |||
117 | Mannoside derivative 4 | Drug Info | [1] | |||
118 | Mannoside derivative 5 | Drug Info | [1] | |||
119 | Mannoside derivative 6 | Drug Info | [1] | |||
120 | Mannoside derivative 7 | Drug Info | [1] | |||
121 | Mannoside derivative 8 | Drug Info | [1] | |||
122 | Mannoside derivative 9 | Drug Info | [1] | |||
123 | PMID26651364-Compound-105 | Drug Info | [1] | |||
124 | PMID26651364-Compound-106 | Drug Info | [1] | |||
125 | PMID26651364-Compound-107 | Drug Info | [1] | |||
126 | PMID26651364-Compound-108 | Drug Info | [1] | |||
127 | PMID26651364-Compound-109 | Drug Info | [1] | |||
128 | PMID26651364-Compound-10a | Drug Info | [1] | |||
129 | PMID26651364-Compound-10b | Drug Info | [1] | |||
130 | PMID26651364-Compound-10c | Drug Info | [1] | |||
131 | PMID26651364-Compound-10d | Drug Info | [1] | |||
132 | PMID26651364-Compound-110 | Drug Info | [1] | |||
133 | PMID26651364-Compound-111 | Drug Info | [1] | |||
134 | PMID26651364-Compound-112 | Drug Info | [1] | |||
135 | PMID26651364-Compound-113 | Drug Info | [1] | |||
136 | PMID26651364-Compound-114 | Drug Info | [1] | |||
137 | PMID26651364-Compound-115 | Drug Info | [1] | |||
138 | PMID26651364-Compound-116 | Drug Info | [1] | |||
139 | PMID26651364-Compound-117a | Drug Info | [1] | |||
140 | PMID26651364-Compound-117b | Drug Info | [1] | |||
141 | PMID26651364-Compound-118 | Drug Info | [1] | |||
142 | PMID26651364-Compound-119 | Drug Info | [1] | |||
143 | PMID26651364-Compound-11b | Drug Info | [1] | |||
144 | PMID26651364-Compound-11c | Drug Info | [1] | |||
145 | PMID26651364-Compound-120 | Drug Info | [1] | |||
146 | PMID26651364-Compound-121 | Drug Info | [1] | |||
147 | PMID26651364-Compound-122 | Drug Info | [1] | |||
148 | PMID26651364-Compound-123 | Drug Info | [1] | |||
149 | PMID26651364-Compound-124 | Drug Info | [1] | |||
150 | PMID26651364-Compound-125 | Drug Info | [1] | |||
151 | PMID26651364-Compound-126a | Drug Info | [1] | |||
152 | PMID26651364-Compound-126b | Drug Info | [1] | |||
153 | PMID26651364-Compound-126c | Drug Info | [1] | |||
154 | PMID26651364-Compound-127 | Drug Info | [1] | |||
155 | PMID26651364-Compound-128 | Drug Info | [1] | |||
156 | PMID26651364-Compound-4 | Drug Info | [1] | |||
157 | PMID26651364-Compound-45 | Drug Info | [1] | |||
158 | PMID26651364-Compound-46 | Drug Info | [1] | |||
159 | PMID26651364-Compound-47 | Drug Info | [1] | |||
160 | PMID26651364-Compound-48 | Drug Info | [1] | |||
161 | PMID26651364-Compound-49 | Drug Info | [1] | |||
162 | PMID26651364-Compound-5 | Drug Info | [1] | |||
163 | PMID26651364-Compound-50 | Drug Info | [1] | |||
164 | PMID26651364-Compound-5a | Drug Info | [1] | |||
165 | PMID26651364-Compound-5b | Drug Info | [1] | |||
166 | PMID26651364-Compound-5c | Drug Info | [1] | |||
167 | PMID26651364-Compound-5d | Drug Info | [1] | |||
168 | PMID26651364-Compound-5e | Drug Info | [1] | |||
169 | PMID26651364-Compound-5f | Drug Info | [1] | |||
170 | PMID26651364-Compound-5g | Drug Info | [1] | |||
171 | PMID26651364-Compound-6a | Drug Info | [1] | |||
172 | PMID26651364-Compound-6b | Drug Info | [1] | |||
173 | PMID26651364-Compound-6c | Drug Info | [1] | |||
174 | PMID26651364-Compound-6d | Drug Info | [1] | |||
175 | PMID26651364-Compound-6e | Drug Info | [1] | |||
176 | PMID26651364-Compound-7a | Drug Info | [1] | |||
177 | PMID26651364-Compound-7b | Drug Info | [1] | |||
178 | PMID26651364-Compound-7c | Drug Info | [1] | |||
179 | PMID26651364-Compound-7d | Drug Info | [1] | |||
180 | PMID26651364-Compound-7e | Drug Info | [1] | |||
181 | PMID26651364-Compound-8a | Drug Info | [1] | |||
182 | PMID26651364-Compound-8b | Drug Info | [1] | |||
183 | PMID26651364-Compound-8c | Drug Info | [1] | |||
184 | PMID26651364-Compound-8d | Drug Info | [1] | |||
185 | PMID26651364-Compound-9a | Drug Info | [1] | |||
186 | PMID26651364-Compound-9b | Drug Info | [1] | |||
187 | PMID26651364-Compound-9c | Drug Info | [1] | |||
188 | PMID26651364-Compound-9d | Drug Info | [1] | |||
189 | PMID26651364-Compound-9e | Drug Info | [1] | |||
190 | PMID26651364-Compound-9f | Drug Info | [1] |
Drug Binding Sites of Target | Top | |||||
---|---|---|---|---|---|---|
Ligand Name: Alpha-D-Mannose | Ligand Info | |||||
Structure Description | Co-crystals in the P212121 space group, of a beta-cyclodextrin spacered by triazole heptyl from alpha-D-mannose, with FimH lectin at 2.00 A resolution. | PDB:6YHW | ||||
Method | X-ray diffraction | Resolution | 1.96 Å | Mutation | No | [9] |
PDB Sequence |
FACKTANGTA
10 IPIGGGSANV20 YVNLAPVVNV30 GQNLVVDLST40 QIFCHNDYPE50 TITDYVTLQR 60 GSAYGGVLSN70 FSGTVKYSGS80 SYPFPTTSET90 PRVVYNSRTD100 KPWPVALYLT 110 PVSSAGGVAI120 KAGSLIAVLI130 LRQTNNYNSD140 DFQFVWNIYA150 NNDVVVPTG |
|||||
|
||||||
Click to View More Binding Site Information of This Target and Ligand Pair | ||||||
Ligand Name: Edetic acid | Ligand Info | |||||
Structure Description | Breaking down the wall: mutation of the tyrosine gate of the universal Escherichia coli fimbrial adhesin FimH | PDB:5FX3 | ||||
Method | X-ray diffraction | Resolution | 1.90 Å | Mutation | Yes | [10] |
PDB Sequence |
FACTANGTAI
11 PIGGGSANVY21 VNLAPVVNVG31 QNLVVDLSTQ41 IFCHNDYPET51 ITDYVTLQRG 61 SAYGGVLSNF71 SGTVKYSGSS81 YPFPTTSETP91 RVVYNSRTDK101 PWPVALYLTP 111 VSSAGGVAIK121 AGSLIAVLIL131 RQTNNANSDD141 FQFVWNIYAN151 NDVVVPT |
|||||
|
||||||
Click to View More Binding Site Information of This Target with Different Ligands |
Different Human System Profiles of Target | Top |
---|---|
Human Similarity Proteins
of target is determined by comparing the sequence similarity of all human proteins with the target based on BLAST. The similarity proteins for a target are defined as the proteins with E-value < 0.005 and outside the protein families of the target.
A target that has fewer human similarity proteins outside its family is commonly regarded to possess a greater capacity to avoid undesired interactions and thus increase the possibility of finding successful drugs
(Brief Bioinform, 21: 649-662, 2020).
Human Similarity Proteins
|
There is no similarity protein (E value < 0.005) for this target
|
Chemical Structure based Activity Landscape of Target | Top |
---|---|
Target Poor or Non Binders | Top | |||||
---|---|---|---|---|---|---|
Target Poor or Non Binders |
References | Top | |||||
---|---|---|---|---|---|---|
REF 1 | Mannose-derived FimH antagonists: a promising anti-virulence therapeutic strategy for urinary tract infections and Crohn's disease.Expert Opin Ther Pat. 2016;26(2):175-97. | |||||
REF 2 | ClinicalTrials.gov (NCT03943446) TAK-018 for Prevention of the Recurrence of Postoperative Crohn's Disease (CD). U.S. National Institutes of Health. | |||||
REF 3 | ClinicalTrials.gov (NCT05138822) A Double-Blind, Double Dummy, Randomized, Phase 1b, Nitrofurantoin Controlled, Repeat Oral Dose Study to Investigate the Safety, Tolerability, Pharmacokinetics and Microbiological Response of GSK3882347 in Female Participants With Acute Uncomplicated Urinary Tract Infection. U.S.National Institutes of Health. | |||||
REF 4 | Different drugs for bad bugs: antivirulence strategies in the age of antibiotic resistance. Nat Rev Drug Discov. 2017 Jul;16(7):457-471. | |||||
REF 5 | Clinical pipeline report, company report or official report of Enterome Biosciences. | |||||
REF 6 | Clinical pipeline report, company report or official report of Fimbrion Therapeutics | |||||
REF 7 | Clinical pipeline report, company report or official report of GlaxoSmithKline | |||||
REF 8 | FimH as a scaffold for regulated molecular recognition. J Biol Eng. 2021 Jan 12;15(1):3. | |||||
REF 9 | The Antiadhesive Strategy in Crohn's Disease: Orally Active Mannosides to Decolonize Pathogenic Escherichia coli from the Gut. Chembiochem. 2016 May 17;17(10):936-52. | |||||
REF 10 | Mutation of Tyr137 of the universal Escherichia coli fimbrial adhesin FimH relaxes the tyrosine gate prior to mannose binding. IUCrJ. 2017 Jan 1;4(Pt 1):7-23. |
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.