Target Information
| Target General Information | Top | |||||
|---|---|---|---|---|---|---|
| Target ID |
T46465
(Former ID: TTDR00106)
|
|||||
| Target Name |
Plasmodium Plasmepsin 2 (Malaria PLA2)
|
|||||
| Synonyms |
Plasmepsin-2; PFAPD; Aspartic hemoglobinase II
Click to Show/Hide
|
|||||
| Gene Name |
Malaria PLA2
|
|||||
| Target Type |
Patented-recorded target
|
[1] | ||||
| Disease | [+] 1 Target-related Diseases | + | ||||
| 1 | Malaria [ICD-11: 1F40-1F45] | |||||
| Function |
Hydrolysis of the bonds linking certain hydrophobic residues in hemoglobin or globin. Also cleaves small molecules substrates such as Ala-Leu-Glu-Arg-Thr-Phe-|-Phe(NO(2))-Ser-Phe-Pro-Thr.
Click to Show/Hide
|
|||||
| BioChemical Class |
Peptidase
|
|||||
| UniProt ID | ||||||
| EC Number |
EC 3.4.23.39
|
|||||
| Sequence |
MDITVREHDFKHGFIKSNSTFDGLNIDNSKNKKKIQKGFQILYVLLFCSVMCGLFYYVYE
NVWLQRDNEMNEILKNSEHLTIGFKVENAHDRILKTIKTHKLKNYIKESVNFLNSGLTKT NYLGSSNDNIELVDFQNIMFYGDAEVGDNQQPFTFILDTGSANLWVPSVKCTTAGCLTKH LYDSSKSRTYEKDGTKVEMNYVSGTVSGFFSKDLVTVGNLSLPYKFIEVIDTNGFEPTYT ASTFDGILGLGWKDLSIGSVDPIVVELKNQNKIENALFTFYLPVHDKHTGFLTIGGIEER FYEGPLTYEKLNHDLYWQITLDAHVGNIMLEKANCIVDSGTSAITVPTDFLNKMLQNLDV IKVPFLPFYVTLCNNSKLPTFEFTSENGKYTLEPEYYLQHIEDVGPGLCMLNIIGLDFPV PTFILGDPFMRKYFTVFDYDNHSVGIALAKKNL Click to Show/Hide
|
|||||
| 3D Structure | Click to Show 3D Structure of This Target | PDB | ||||
| Drugs and Modes of Action | Top | |||||
|---|---|---|---|---|---|---|
| Discontinued Drug(s) | [+] 1 Discontinued Drugs | + | ||||
| 1 | Pepstatin | Drug Info | Terminated | Malaria | [2] | |
| Mode of Action | [+] 1 Modes of Action | + | ||||
| Inhibitor | [+] 73 Inhibitor drugs | + | ||||
| 1 | US9353089, 135 | Drug Info | [3] | |||
| 2 | US9353089, 327 | Drug Info | [3] | |||
| 3 | US9353089, 330 | Drug Info | [3] | |||
| 4 | Pepstatin | Drug Info | [1] | |||
| 5 | E-64 | Drug Info | [4] | |||
| 6 | KNI-10006 | Drug Info | [5] | |||
| 7 | KNI-10033 | Drug Info | [6] | |||
| 8 | KNI-10061 | Drug Info | [6] | |||
| 9 | KNI-10062 | Drug Info | [6] | |||
| 10 | KNI-10074 | Drug Info | [7] | |||
| 11 | KNI-10079 | Drug Info | [7] | |||
| 12 | KNI-10080 | Drug Info | [7] | |||
| 13 | KNI-10081 | Drug Info | [7] | |||
| 14 | KNI-10087 | Drug Info | [7] | |||
| 15 | KNI-10088 | Drug Info | [7] | |||
| 16 | KNI-10092 | Drug Info | [7] | |||
| 17 | KNI-10093 | Drug Info | [7] | |||
| 18 | KNI-10094 | Drug Info | [7] | |||
| 19 | KNI-10095 | Drug Info | [7] | |||
| 20 | KNI-10106 | Drug Info | [7] | |||
| 21 | KNI-10113 | Drug Info | [7] | |||
| 22 | KNI-10124 | Drug Info | [7] | |||
| 23 | KNI-10125 | Drug Info | [7] | |||
| 24 | KNI-10152 | Drug Info | [7] | |||
| 25 | KNI-10155 | Drug Info | [7] | |||
| 26 | KNI-10216 | Drug Info | [7] | |||
| 27 | KNI-10217 | Drug Info | [7] | |||
| 28 | KNI-10232 | Drug Info | [6] | |||
| 29 | KNI-10255 | Drug Info | [7] | |||
| 30 | KNI-10256 | Drug Info | [7] | |||
| 31 | KNI-10260 | Drug Info | [7] | |||
| 32 | KNI-10265 | Drug Info | [7] | |||
| 33 | KNI-10266 | Drug Info | [7] | |||
| 34 | KNI-10282 | Drug Info | [7] | |||
| 35 | KNI-10283 | Drug Info | [7] | |||
| 36 | KNI-10313 | Drug Info | [6] | |||
| 37 | KNI-10314 | Drug Info | [6] | |||
| 38 | KNI-10315 | Drug Info | [6] | |||
| 39 | KNI-10316 | Drug Info | [6] | |||
| 40 | KNI-10332 | Drug Info | [6] | |||
| 41 | KNI-10341 | Drug Info | [6] | |||
| 42 | KNI-10342 | Drug Info | [6] | |||
| 43 | KNI-10368 | Drug Info | [6] | |||
| 44 | KNI-10369 | Drug Info | [7] | |||
| 45 | KNI-10372 | Drug Info | [6] | |||
| 46 | KNI-10526 | Drug Info | [7] | |||
| 47 | KNI-10527 | Drug Info | [7] | |||
| 48 | KNI-10529 | Drug Info | [7] | |||
| 49 | KNI-10538 | Drug Info | [5] | |||
| 50 | KNI-10539 | Drug Info | [7] | |||
| 51 | KNI-10541 | Drug Info | [7] | |||
| 52 | KNI-10737 | Drug Info | [5] | |||
| 53 | KNI-10740 | Drug Info | [5] | |||
| 54 | KNI-10741 | Drug Info | [5] | |||
| 55 | KNI-10742 | Drug Info | [5] | |||
| 56 | KNI-10743 | Drug Info | [5] | |||
| 57 | KNI-10758 | Drug Info | [5] | |||
| 58 | KNI-10759 | Drug Info | [5] | |||
| 59 | KNI-10760 | Drug Info | [5] | |||
| 60 | KNI-10761 | Drug Info | [5] | |||
| 61 | KNI-10762 | Drug Info | [5] | |||
| 62 | KNI-10763 | Drug Info | [5] | |||
| 63 | KNI-1293 | Drug Info | [7] | |||
| 64 | KNI-227 | Drug Info | [6] | |||
| 65 | KNI-727 | Drug Info | [8] | |||
| 66 | Leupeptin | Drug Info | [1] | |||
| 67 | N-(R-Carboxy-Ethyl)-Alpha-(S)-(2-Phenylethyl) | Drug Info | [9] | |||
| 68 | PS-154636-1 | Drug Info | [10] | |||
| 69 | PS-222036 | Drug Info | [10] | |||
| 70 | PS-444035 | Drug Info | [10] | |||
| 71 | PS-662477 | Drug Info | [10] | |||
| 72 | PS-725074 | Drug Info | [10] | |||
| 73 | PS-777621 | Drug Info | [11] | |||
| Chemical Structure based Activity Landscape of Target | Top |
|---|---|
| Drug Property Profile of Target | Top | |
|---|---|---|
| (1) Molecular Weight (mw) based Drug Clustering | (2) Octanol/Water Partition Coefficient (xlogp) based Drug Clustering | |
|
|
||
| (3) Hydrogen Bond Donor Count (hbonddonor) based Drug Clustering | (4) Hydrogen Bond Acceptor Count (hbondacc) based Drug Clustering | |
|
|
||
| (5) Rotatable Bond Count (rotbonds) based Drug Clustering | (6) Topological Polar Surface Area (polararea) based Drug Clustering | |
|
|
||
| "RO5" indicates the cutoff set by lipinski's rule of five; "D123AB" colored in GREEN denotes the no violation of any cutoff in lipinski's rule of five; "D123AB" colored in PURPLE refers to the violation of only one cutoff in lipinski's rule of five; "D123AB" colored in BLACK represents the violation of more than one cutoffs in lipinski's rule of five | ||
| Target Poor or Non Binders | Top | |||||
|---|---|---|---|---|---|---|
| Target Poor or Non Binders | ||||||
| Target-Related Models and Studies | Top | |||||
|---|---|---|---|---|---|---|
| Target Validation | ||||||
| References | Top | |||||
|---|---|---|---|---|---|---|
| REF 1 | Novel molecular targets for antimalarial chemotherapy. Int J Antimicrob Agents. 2007 Jul;30(1):4-10. | |||||
| REF 2 | Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800004280) | |||||
| REF 3 | Compositions and methods for the treatment of malaria. US9353089. | |||||
| REF 4 | Antimalarial synergy of cysteine and aspartic protease inhibitors. Antimicrob Agents Chemother. 1998 Sep;42(9):2254-8. | |||||
| REF 5 | Improvement of both plasmepsin inhibitory activity and antimalarial activity by 2-aminoethylamino substitution. Bioorg Med Chem Lett. 2010 Aug 15;20(16):4836-9. | |||||
| REF 6 | Additional interaction of allophenylnorstatine-containing tripeptidomimetics with malarial aspartic protease plasmepsin II. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3048-52. | |||||
| REF 7 | Antimalarial activity enhancement in hydroxymethylcarbonyl (HMC) isostere-based dipeptidomimetics targeting malarial aspartic protease plasmepsin. Bioorg Med Chem. 2008 Dec 1;16(23):10049-60. | |||||
| REF 8 | Identification and characterization of allophenylnorstatine-based inhibitors of plasmepsin II, an antimalarial target. Biochemistry. 2002 Feb 19;41(7):2273-80. | |||||
| REF 9 | How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6. | |||||
| REF 10 | Identification of potent inhibitors of Plasmodium falciparum plasmepsin II from an encoded statine combinatorial library. Bioorg Med Chem Lett. 1998 Sep 8;8(17):2315-20. | |||||
| REF 11 | High antiplasmodial activity of novel plasmepsins I and II inhibitors. J Med Chem. 2006 Dec 14;49(25):7440-9. | |||||
If You Find Any Error in Data or Bug in Web Service, Please Kindly Report It to Dr. Zhou and Dr. Zhang.